(data stored in ACNUC7421 zone)

EMBL: CP002299.PE44

CP002299.PE44        Location/Qualifiers
FT   CDS             complement(49394..50275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0044"
FT                   /product="methyltransferase"
FT                   /note="KEGG: fal:FRAAL3616 hypothetical protein; TIGRFAM:
FT                   methyltransferase; PFAM: Leucine carboxyl
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78132"
FT                   /db_xref="GOA:E3J294"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3J294"
FT                   /inference="protein motif:TFAM:TIGR00027"
FT                   /protein_id="ADP78132.1"
FT                   /translation="MRAEGGSRTAVLTCQGRAVADGSSAAGRFADAVAADLLRPDERLV
FT                   VEQVRAGTPPKGVAARMAYESAKACASVMVPRTIAADDAIRDRPGGVASQLVLLGAGLD
FT                   ARAWRMPELAGTDVFEVDHPASQRDKRDRLAGRPSLARSLTFVPVDFSRDKLAEALAAA
FT                   GFQTSEPTTWVWEGVVPYLTPAEVSATTAAAGELSAPGSRLVVLYLTPNARASVGVLVA
FT                   RTMSALARQRSVWADEPRRSAWTPPKLAALLATHGFAVTRDESLLAISERLGLPGTRGA
FT                   SIAHAHLAVADR"
     MRAEGGSRTA VLTCQGRAVA DGSSAAGRFA DAVAADLLRP DERLVVEQVR AGTPPKGVAA        60
     RMAYESAKAC ASVMVPRTIA ADDAIRDRPG GVASQLVLLG AGLDARAWRM PELAGTDVFE       120
     VDHPASQRDK RDRLAGRPSL ARSLTFVPVD FSRDKLAEAL AAAGFQTSEP TTWVWEGVVP       180
     YLTPAEVSAT TAAAGELSAP GSRLVVLYLT PNARASVGVL VARTMSALAR QRSVWADEPR       240
     RSAWTPPKLA ALLATHGFAV TRDESLLAIS ERLGLPGTRG ASIAHAHLAV ADR              293
//

If you have problems or comments...

PBIL Back to PBIL home page