(data stored in ACNUC7421 zone)

EMBL: CP002299.PE441

CP002299.PE441       Location/Qualifiers
FT   CDS             538861..539475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0446"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: scb:SCAB_7561
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78529"
FT                   /db_xref="GOA:E3J9W7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9W7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADP78529.1"
FT                   /translation="MRSVADTRGRVLDATLACLVRHGYGGTTARAIGQVGGFAPGVIYY
FT                   HFTDLDDVLVAALTTTCEGRVQRYREALAGIDRAGPAVEALRALYLEDTEVGHIAAVQE
FT                   IYAGARPGSRLAAQLALETRRWEEVAVELLTTLLTGKPFATVIRMPVLANAAVAFYLGA
FT                   ETLAHLDDDSTRMTEFFDQAARLAVYFDRIPRLRKRGQQAL"
     MRSVADTRGR VLDATLACLV RHGYGGTTAR AIGQVGGFAP GVIYYHFTDL DDVLVAALTT        60
     TCEGRVQRYR EALAGIDRAG PAVEALRALY LEDTEVGHIA AVQEIYAGAR PGSRLAAQLA       120
     LETRRWEEVA VELLTTLLTG KPFATVIRMP VLANAAVAFY LGAETLAHLD DDSTRMTEFF       180
     DQAARLAVYF DRIPRLRKRG QQAL                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page