(data stored in ACNUC7421 zone)

EMBL: CP002299.PE443

CP002299.PE443       Location/Qualifiers
FT   CDS             541261..542529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0448"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cel:T28H11.1 Sperm-Specific family, class Q"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78531"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9W9"
FT                   /inference="similar to AA sequence:KEGG:T28H11.1"
FT                   /protein_id="ADP78531.1"
FT                   /translation="MTFYPRNAALRVGTLLGGPVLAAAVLTASPATAAPASPQAIPPIL
FT                   LAGDQSQTGAVDISPTGVVVGTTQAPPPANIPGGTSPSTPLRWLPTPTGYVKQTLSLPA
FT                   GATSATVTGVTDLGEAGGTLTTAAGQQPVRWSVSGLQTTALGPPGSSTTTAVGPGHWAV
FT                   ETGDTISGTATLFARDGSTTALAGTPELAGARIVTAVSIGGPGTVLLGAISGVGMGTTG
FT                   RAVVWRSGSTVSLPVISAFSIGSACLSAIQPDGSVAYSGVVINPAPAQVIGVHRGGVPG
FT                   TEVALPTGGRTATLGCSPAGGPVDALASDGSVVGQLLAAPGQPAEAALWRDGALVPLGV
FT                   AAGETATTAAAVASGGRVILVATTTAGVQQPYLWTNGVRVPLTLPAGWTLRTIVKFTDA
FT                   GAVLGAVQNAAGDIRPVVWRTRG"
     MTFYPRNAAL RVGTLLGGPV LAAAVLTASP ATAAPASPQA IPPILLAGDQ SQTGAVDISP        60
     TGVVVGTTQA PPPANIPGGT SPSTPLRWLP TPTGYVKQTL SLPAGATSAT VTGVTDLGEA       120
     GGTLTTAAGQ QPVRWSVSGL QTTALGPPGS STTTAVGPGH WAVETGDTIS GTATLFARDG       180
     STTALAGTPE LAGARIVTAV SIGGPGTVLL GAISGVGMGT TGRAVVWRSG STVSLPVISA       240
     FSIGSACLSA IQPDGSVAYS GVVINPAPAQ VIGVHRGGVP GTEVALPTGG RTATLGCSPA       300
     GGPVDALASD GSVVGQLLAA PGQPAEAALW RDGALVPLGV AAGETATTAA AVASGGRVIL       360
     VATTTAGVQQ PYLWTNGVRV PLTLPAGWTL RTIVKFTDAG AVLGAVQNAA GDIRPVVWRT       420
     RG                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page