(data stored in ACNUC7421 zone)

EMBL: CP002299.PE445

CP002299.PE445       Location/Qualifiers
FT   CDS             complement(543780..545219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0450"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: fal:FRAAL4295 putative FAD-dependent
FT                   dehydrogenase; putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78533"
FT                   /db_xref="GOA:E3J9X1"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9X1"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADP78533.1"
FT                   /translation="MKNSVALARTARMIEALRQRGADQAQDVTARPEDGSAGGAPPRDT
FT                   RRPRVVVVGGGFAGLGVLRHLEARLPADAADLELVSPTDHLLYTSLLPQVCAGEVEPRH
FT                   LAIPLRASLRRTTLRTGHAVDVDTAARTITVVDGNGSFRLGWDRLVLAPGSLTRTFDIP
FT                   GLAQYGLGLKNLAEAVYLRDHVLRQLEYASTCPDPAERRARGTFVVCGAGYTGTELAAQ
FT                   MRRFTLDALRYFPRLAADDVRWILLDRAPRVLPELDETLGAGALKVLRDRGVEVWPQTS
FT                   VTRVTADSVTLSNGETVPAHTLVWCTGVTPNPLMEKVGTETSKGRLVVDERLNVPGAAG
FT                   VFALGDAAAVPDVTRGGAPAGQTAQHAVRQGAAAGRNIAASLGYGKASPYRHRDLGFVV
FT                   DLGAGDAVANPLGLHLSGAPAALVTRTYHLLALGTGTNRAHVACDWLLAAAFPEQVVQL
FT                   GFLPPPHATIAEIEDTRLYPN"
     MKNSVALART ARMIEALRQR GADQAQDVTA RPEDGSAGGA PPRDTRRPRV VVVGGGFAGL        60
     GVLRHLEARL PADAADLELV SPTDHLLYTS LLPQVCAGEV EPRHLAIPLR ASLRRTTLRT       120
     GHAVDVDTAA RTITVVDGNG SFRLGWDRLV LAPGSLTRTF DIPGLAQYGL GLKNLAEAVY       180
     LRDHVLRQLE YASTCPDPAE RRARGTFVVC GAGYTGTELA AQMRRFTLDA LRYFPRLAAD       240
     DVRWILLDRA PRVLPELDET LGAGALKVLR DRGVEVWPQT SVTRVTADSV TLSNGETVPA       300
     HTLVWCTGVT PNPLMEKVGT ETSKGRLVVD ERLNVPGAAG VFALGDAAAV PDVTRGGAPA       360
     GQTAQHAVRQ GAAAGRNIAA SLGYGKASPY RHRDLGFVVD LGAGDAVANP LGLHLSGAPA       420
     ALVTRTYHLL ALGTGTNRAH VACDWLLAAA FPEQVVQLGF LPPPHATIAE IEDTRLYPN        479
//

If you have problems or comments...

PBIL Back to PBIL home page