(data stored in ACNUC7421 zone)

EMBL: CP002299.PE447

CP002299.PE447       Location/Qualifiers
FT   CDS             545782..546666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0452"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6489 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78535"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9X3"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6489"
FT                   /protein_id="ADP78535.1"
FT                   /translation="MTMSDRSGRNLIASSARTRWKRRLTGLALLVAGAAAVIPAQGALA
FT                   AGNGPQPPSTRVDAAIKAAYLQAFTGGQNQAHNLAAVEDGPALASTLALAEQNFPAATS
FT                   PSQVTVSGIKIKGPAKAALRFDVVYQGGYDIGQRDGTAVVVDRQWKVSRDTFCSVLSLA
FT                   GAVCPPKAGRPPRDPAAARLAIQQAYTRAFTGGEDPAYSLGAVEDGPALAGTLAQAMQN
FT                   FPGATSTAAVTTGDIVFTSPRSAALPFHITYQQGADFGVQNGTAVIVGGQWKVSRQTYC
FT                   TVMGWAGATCPAP"
     MTMSDRSGRN LIASSARTRW KRRLTGLALL VAGAAAVIPA QGALAAGNGP QPPSTRVDAA        60
     IKAAYLQAFT GGQNQAHNLA AVEDGPALAS TLALAEQNFP AATSPSQVTV SGIKIKGPAK       120
     AALRFDVVYQ GGYDIGQRDG TAVVVDRQWK VSRDTFCSVL SLAGAVCPPK AGRPPRDPAA       180
     ARLAIQQAYT RAFTGGEDPA YSLGAVEDGP ALAGTLAQAM QNFPGATSTA AVTTGDIVFT       240
     SPRSAALPFH ITYQQGADFG VQNGTAVIVG GQWKVSRQTY CTVMGWAGAT CPAP             294
//

If you have problems or comments...

PBIL Back to PBIL home page