(data stored in ACNUC7421 zone)

EMBL: CP002299.PE448

CP002299.PE448       Location/Qualifiers
FT   CDS             complement(546825..549938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0453"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="KEGG: nca:Noca_2322
FT                   endonuclease/exonuclease/phosphatase; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; Carbohydrate-binding
FT                   family V/XII; SMART: Carbohydrate-binding family V/XII"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78536"
FT                   /db_xref="GOA:E3J9X4"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9X4"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ADP78536.1"
FT                   /translation="MPRVPRRRIAAAVLSAGIGSVSLAAPALANPGATGLVISEAYLNG
FT                   GSSGASYLNKFVELFNPTASPVALTGDTLQYRAPTSTVTPSGAQVFALSGTVAAHGHFL
FT                   IQLPSNNATTNPGAPLPTPDLSTGGSINPGAGGGTLFLAASTAGVLPTDASVLDKIGWG
FT                   TSNSPEGTAPTGNSVVLSYQRDAAGTDTDNNAADFSVAAPTPQNAASDGGATGGGTVTV
FT                   ASPGTLNATVGTAIAPVTLAASGGTAPYTWTATGLPAGLAISTAGVLSGTPTAAGTASV
FT                   TATATDSTAATGSVSFTVQVVDAAPTVTPIAAIQGTNTDTSPLAGQTVTTEGVVTAAYP
FT                   TGGFNGFFLETGGAGGTAAQDATPGTSDAVFVFGSVSAGQVTVGESVRVTGKVSEFQGE
FT                   TEIGSPTVTQLDTPLPAVVPDQLAWSDLSTDAQKEAHEGELIAPQGDFTVSDNYDANWY
FT                   GSFTLAAGDTPLRQPTDVGTAGSPAAQSAAADNAARMITLDDGSSVNYSTGANANTPLP
FT                   WLTPTNPVSVGAKVTFHKPLVLDYRFSLWNLQPTAQVTDDGAAVATFSDTRTGNAQPAN
FT                   VGGGARLATFNVENYFSMTGEQYVSMGLGTCTYYTDRQGNRIGVNTCTGTDGSPGPRGA
FT                   ANDASFARQQSKIVTGINRLGASIVSLEEVENSSKFGEPRDTTLAGLVGALNAAAGSNV
FT                   WEFVPSPPDDQLPPLAQQDVIRTAFIYKPAAVSLVGAAKVLTGDSADGQPFSIAREPLA
FT                   QGFKKAGATDKDAFLVVANHLKSKGADATGLYPGDAEDTSSPAVDQGAFNATRVHQVTD
FT                   LSAFATQTAAGLGTNRIFLLGDFNAYTGEDPMQVLYGAGYVDLGSTLDPAEQTYSYNSL
FT                   EGSLDHVLANPAALSMVTGADVWQINAQEAVAFAYSRYNYNATQLFNGTDPFAASDHDP
FT                   VVVGLTLPATPLPAAWSASKVYNAPDTVTYNGSTWQAMWWTQNQTPGDPNGPWEQIATA
FT                   PDGIALWTASRVFNTGDVAEYQGKKYVAQWWTRNQAPGDPNGPWKLSS"
     MPRVPRRRIA AAVLSAGIGS VSLAAPALAN PGATGLVISE AYLNGGSSGA SYLNKFVELF        60
     NPTASPVALT GDTLQYRAPT STVTPSGAQV FALSGTVAAH GHFLIQLPSN NATTNPGAPL       120
     PTPDLSTGGS INPGAGGGTL FLAASTAGVL PTDASVLDKI GWGTSNSPEG TAPTGNSVVL       180
     SYQRDAAGTD TDNNAADFSV AAPTPQNAAS DGGATGGGTV TVASPGTLNA TVGTAIAPVT       240
     LAASGGTAPY TWTATGLPAG LAISTAGVLS GTPTAAGTAS VTATATDSTA ATGSVSFTVQ       300
     VVDAAPTVTP IAAIQGTNTD TSPLAGQTVT TEGVVTAAYP TGGFNGFFLE TGGAGGTAAQ       360
     DATPGTSDAV FVFGSVSAGQ VTVGESVRVT GKVSEFQGET EIGSPTVTQL DTPLPAVVPD       420
     QLAWSDLSTD AQKEAHEGEL IAPQGDFTVS DNYDANWYGS FTLAAGDTPL RQPTDVGTAG       480
     SPAAQSAAAD NAARMITLDD GSSVNYSTGA NANTPLPWLT PTNPVSVGAK VTFHKPLVLD       540
     YRFSLWNLQP TAQVTDDGAA VATFSDTRTG NAQPANVGGG ARLATFNVEN YFSMTGEQYV       600
     SMGLGTCTYY TDRQGNRIGV NTCTGTDGSP GPRGAANDAS FARQQSKIVT GINRLGASIV       660
     SLEEVENSSK FGEPRDTTLA GLVGALNAAA GSNVWEFVPS PPDDQLPPLA QQDVIRTAFI       720
     YKPAAVSLVG AAKVLTGDSA DGQPFSIARE PLAQGFKKAG ATDKDAFLVV ANHLKSKGAD       780
     ATGLYPGDAE DTSSPAVDQG AFNATRVHQV TDLSAFATQT AAGLGTNRIF LLGDFNAYTG       840
     EDPMQVLYGA GYVDLGSTLD PAEQTYSYNS LEGSLDHVLA NPAALSMVTG ADVWQINAQE       900
     AVAFAYSRYN YNATQLFNGT DPFAASDHDP VVVGLTLPAT PLPAAWSASK VYNAPDTVTY       960
     NGSTWQAMWW TQNQTPGDPN GPWEQIATAP DGIALWTASR VFNTGDVAEY QGKKYVAQWW      1020
     TRNQAPGDPN GPWKLSS                                                     1037
//

If you have problems or comments...

PBIL Back to PBIL home page