(data stored in ACNUC7421 zone)

EMBL: CP002299.PE449

CP002299.PE449       Location/Qualifiers
FT   CDS             550394..551371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0454"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rce:RC1_3994 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78537"
FT                   /db_xref="GOA:E3J9X5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9X5"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP78537.1"
FT                   /translation="MTESRVPEVSIGIPVYNGADFLGAAIESHLAQTFGDFELVISDNA
FT                   STDGTQDLCRAYAKEDSRIRYVRQAANIGANANYNEVARISRAPFFRWAADDDVLLPEY
FT                   LEQTYRLLSNDDDAVLCHSFAAHIDENGKPLAPAADGVGFVDDKGTYVDGPDPNVATRK
FT                   MRSPYPHVRFRDVLLHTKWCFEIFGLIRRDVLLATPLHQKFYGTDRVLLAELALRGTWR
FT                   VVEEPLWQRRSHSGASNNMSVWQKAQWSNPDAKKSVLPPVTNMIRGYADAVHRQRFPII
FT                   EREQCYAAIGVLAVQPDKFRKLLVPGPHNYFGIGNKKSDASHRL"
     MTESRVPEVS IGIPVYNGAD FLGAAIESHL AQTFGDFELV ISDNASTDGT QDLCRAYAKE        60
     DSRIRYVRQA ANIGANANYN EVARISRAPF FRWAADDDVL LPEYLEQTYR LLSNDDDAVL       120
     CHSFAAHIDE NGKPLAPAAD GVGFVDDKGT YVDGPDPNVA TRKMRSPYPH VRFRDVLLHT       180
     KWCFEIFGLI RRDVLLATPL HQKFYGTDRV LLAELALRGT WRVVEEPLWQ RRSHSGASNN       240
     MSVWQKAQWS NPDAKKSVLP PVTNMIRGYA DAVHRQRFPI IEREQCYAAI GVLAVQPDKF       300
     RKLLVPGPHN YFGIGNKKSD ASHRL                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page