(data stored in ACNUC7421 zone)

EMBL: CP002299.PE45

CP002299.PE45        Location/Qualifiers
FT   CDS             complement(50278..51627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0045"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; Methyltransferase type
FT                   11; KEGG: cwo:Cwoe_1969 OsmC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78133"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E3J295"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ADP78133.1"
FT                   /translation="MVAPAETAAVRPTPPTHSYSVTCEWSGSTGVGYDRYSRAHVGHAP
FT                   PAATAVRLSSDPAFRGDPSLLNPEQLVVLAAASCQLLAFLAIAARARVDVRDYQDTGSA
FT                   VMTEDGRGGGAITEITLRPRITVVTDATEERLRRLAQLAHEQCFIAASLNCPVNVSPTF
FT                   EILTPYAFRDTDTAARRLALVSDVFDPGSRAFIHDRVRAAGLSDVRLAVDLGCGPGHTT
FT                   RLLAAATGAARTVGLDASTAFVATAVGTEPVSAQGGGLSADGATELAFLRHDVSRLPFP
FT                   AQARKADVVYARLLLPHLVDVTDAIGGWITQVAPHGLLLLDEVESIDTDQPALAAYLDH
FT                   ARHLLAARGTTLHAGRLVNTALHDLAAHSPGTSFEVEYNATEPVRPPVPAAAEMFGLNL
FT                   AVWRDDPLYRDRQPELDRLAADLAALAAGPEHDGHITWTMRRVAVRRLAG"
     MVAPAETAAV RPTPPTHSYS VTCEWSGSTG VGYDRYSRAH VGHAPPAATA VRLSSDPAFR        60
     GDPSLLNPEQ LVVLAAASCQ LLAFLAIAAR ARVDVRDYQD TGSAVMTEDG RGGGAITEIT       120
     LRPRITVVTD ATEERLRRLA QLAHEQCFIA ASLNCPVNVS PTFEILTPYA FRDTDTAARR       180
     LALVSDVFDP GSRAFIHDRV RAAGLSDVRL AVDLGCGPGH TTRLLAAATG AARTVGLDAS       240
     TAFVATAVGT EPVSAQGGGL SADGATELAF LRHDVSRLPF PAQARKADVV YARLLLPHLV       300
     DVTDAIGGWI TQVAPHGLLL LDEVESIDTD QPALAAYLDH ARHLLAARGT TLHAGRLVNT       360
     ALHDLAAHSP GTSFEVEYNA TEPVRPPVPA AAEMFGLNLA VWRDDPLYRD RQPELDRLAA       420
     DLAALAAGPE HDGHITWTMR RVAVRRLAG                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page