(data stored in ACNUC7421 zone)

EMBL: CP002299.PE454

CP002299.PE454       Location/Qualifiers
FT   CDS             complement(555838..557034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0459"
FT                   /product="response regulator receiver modulated serine
FT                   phosphatase"
FT                   /note="KEGG: fal:FRAAL0651 putative sensory transduction
FT                   histidine kinase; PFAM: Stage II sporulation protein E;
FT                   response regulator receiver; SMART: protein phosphatase 2C
FT                   domain protein; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78542"
FT                   /db_xref="GOA:E3J9Y0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Y0"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADP78542.1"
FT                   /translation="MQSVAELPAPAAAEPSQTAWPVLLVEDDDGDAFLVEELLQETAAP
FT                   VRLLRATTIAEARTKAAGARCILLDLGLPDSHGLSALETLRRIAPDAAIVVLTGLADEH
FT                   RGIEAMAAGAQDYLVKGEADGKTLVRALRYAIERRAAEQAARDLHESQLRAEENSRLER
FT                   GLLPTPLLRDTRLRPTTRYRPGRRQALLGGDFYDIVETPDHVVHVLLGDVCGHGPDEAA
FT                   LGASLRIAWRTLVLSGIPEPDRLTYLQDVLASERTNEELFATVCTLAIAPDRTTLTMRL
FT                   AGHPPPALIHPHLTALPDTEVGPALGVLDDLLPSERITVPLPPGWELLLATDGLLEGRD
FT                   GPTGERLGWNGVLTEIATINPPPGDDNLPDVLIDRIERRNGGPLTDDVALLLLRGPTP"
     MQSVAELPAP AAAEPSQTAW PVLLVEDDDG DAFLVEELLQ ETAAPVRLLR ATTIAEARTK        60
     AAGARCILLD LGLPDSHGLS ALETLRRIAP DAAIVVLTGL ADEHRGIEAM AAGAQDYLVK       120
     GEADGKTLVR ALRYAIERRA AEQAARDLHE SQLRAEENSR LERGLLPTPL LRDTRLRPTT       180
     RYRPGRRQAL LGGDFYDIVE TPDHVVHVLL GDVCGHGPDE AALGASLRIA WRTLVLSGIP       240
     EPDRLTYLQD VLASERTNEE LFATVCTLAI APDRTTLTMR LAGHPPPALI HPHLTALPDT       300
     EVGPALGVLD DLLPSERITV PLPPGWELLL ATDGLLEGRD GPTGERLGWN GVLTEIATIN       360
     PPPGDDNLPD VLIDRIERRN GGPLTDDVAL LLLRGPTP                               398
//

If you have problems or comments...

PBIL Back to PBIL home page