(data stored in ACNUC7421 zone)

EMBL: CP002299.PE463

CP002299.PE463       Location/Qualifiers
FT   CDS             568374..568973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0468"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dwi:Dwil_GK23793 GK23793 gene product from
FT                   transcript GK23793-RA"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78551"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Y9"
FT                   /inference="similar to AA sequence:KEGG:Dwil_GK23793"
FT                   /protein_id="ADP78551.1"
FT                   /translation="MATVAGAALLPLAGCQPAASSSLASATVSPAADSATAQPADPSTE
FT                   GSNLPAPTQTAPVATATALPTATPGTPRPRIPAARGTGGPGSETITITSPVAVSGHVDT
FT                   TVTCGVTGNHYTASASAVVQGYTVAETVVAANYHAPGTYTILVTVSLTIPGEGRYVITA
FT                   VPASAQITDTGGSVSFSATSDSGRTLAGSIAWACSV"
     MATVAGAALL PLAGCQPAAS SSLASATVSP AADSATAQPA DPSTEGSNLP APTQTAPVAT        60
     ATALPTATPG TPRPRIPAAR GTGGPGSETI TITSPVAVSG HVDTTVTCGV TGNHYTASAS       120
     AVVQGYTVAE TVVAANYHAP GTYTILVTVS LTIPGEGRYV ITAVPASAQI TDTGGSVSFS       180
     ATSDSGRTLA GSIAWACSV                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page