(data stored in ACNUC7421 zone)

EMBL: CP002299.PE464

CP002299.PE464       Location/Qualifiers
FT   CDS             568986..569612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0469"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78552"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Z0"
FT                   /inference="similar to AA sequence:KEGG:Sare_0339"
FT                   /protein_id="ADP78552.1"
FT                   /translation="MIPDGQLVAEPVGATVGGARRWRWLVALSLVVLLGLLLADRLLVG
FT                   VVEDRLSARLSCLGALTGTRTVHIGGFPFLTQMAEGHYRVVTVTADGVGASARLTDVDV
FT                   TFHDVRMRPLAGLVGRSAPGSITVGSISARATVMFGSAGPASGLGAGDALLDAAGSGRL
FT                   DEPIARLAGLPFPVHLDGAQPVPGGVRVALSVPGTAISGVGRCQS"
     MIPDGQLVAE PVGATVGGAR RWRWLVALSL VVLLGLLLAD RLLVGVVEDR LSARLSCLGA        60
     LTGTRTVHIG GFPFLTQMAE GHYRVVTVTA DGVGASARLT DVDVTFHDVR MRPLAGLVGR       120
     SAPGSITVGS ISARATVMFG SAGPASGLGA GDALLDAAGS GRLDEPIARL AGLPFPVHLD       180
     GAQPVPGGVR VALSVPGTAI SGVGRCQS                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page