(data stored in ACNUC7421 zone)

EMBL: CP002299.PE465

CP002299.PE465       Location/Qualifiers
FT   CDS             complement(569696..570502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0470"
FT                   /product="precorrin-6x reductase"
FT                   /EC_number="1.3.1.54"
FT                   /note="TIGRFAM: precorrin-6x reductase; KEGG: rop:ROP_05640
FT                   precorrin-6X reductase; PFAM: Precorrin-6x reductase
FT                   CbiJ/CobK"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78553"
FT                   /db_xref="GOA:E3J9Z1"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Z1"
FT                   /inference="protein motif:TFAM:TIGR00715"
FT                   /protein_id="ADP78553.1"
FT                   /translation="MRVLILGGTREARDLAALLVAEPGMVVTTSLAGRVRDPALPAGEI
FT                   VIGGFGGVAGLRAFLRDRAIDVVVDATHPFATTMSEHAVAVCVGPPDDAPPTAPGAGVP
FT                   LVRLARPGWTERPGDGWHRVADLRTAADQARALCPPGGAVFVTTGRRQLAPFAADPYRH
FT                   YVIRAVDPPTDVLPPRHTVLLDRGPYTVEGETRLMRDHGVRVLVTKDSGGALTAAKLDA
FT                   ARALGLPVVMVDRPALTDPAPPTWSNVAGVLGALHALASSQRPGAR"
     MRVLILGGTR EARDLAALLV AEPGMVVTTS LAGRVRDPAL PAGEIVIGGF GGVAGLRAFL        60
     RDRAIDVVVD ATHPFATTMS EHAVAVCVGP PDDAPPTAPG AGVPLVRLAR PGWTERPGDG       120
     WHRVADLRTA ADQARALCPP GGAVFVTTGR RQLAPFAADP YRHYVIRAVD PPTDVLPPRH       180
     TVLLDRGPYT VEGETRLMRD HGVRVLVTKD SGGALTAAKL DAARALGLPV VMVDRPALTD       240
     PAPPTWSNVA GVLGALHALA SSQRPGAR                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page