(data stored in ACNUC7421 zone)

EMBL: CP002299.PE473

CP002299.PE473       Location/Qualifiers
FT   CDS             579782..583462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0478"
FT                   /product="cobaltochelatase, CobN subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="TIGRFAM: cobaltochelatase, CobN subunit; KEGG:
FT                   fal:FRAAL2330 cobaltochelatase subunit CobN; PFAM:
FT                   CobN/magnesium chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78561"
FT                   /db_xref="GOA:E3J9Z9"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011953"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9Z9"
FT                   /inference="protein motif:TFAM:TIGR02257"
FT                   /protein_id="ADP78561.1"
FT                   /translation="MILLLSTSDTDLSCARACGEDYRLGNPARLDVADLPGLLDGVDVV
FT                   VLRLLGGRRAWPEGVDALLARGLPVVVLSGELIPDAELMELSSVPAGVSAQAHAYLAHG
FT                   GPDNLRQLARFLSDALLLTGLGFDPPVPTPAWGLRPRPDTAAPDERPTVAILYYRAHEL
FT                   AGNTAFVDALADAVDAAGGRAVPVFCASLRTADTELLAELGRAATLVTTVLAAGGAALG
FT                   AIPAEVGAGGRDEDWDIGALAALDVPILQALAVTSSREQWEASDDGLSPLDTATQVAIP
FT                   EFDGRIITVPFSFKEIDADGLSRYVPDPERAARVAGLAVRHARLRHVANADKRIALVLS
FT                   AYPTKHARIGNAVGLDTPASVLALLGALREAGYDVGPETGPGALPGLEAGDGDAFIHGL
FT                   IAAGGQDEDWLTAEHLAGNPVRVPAAVYRSWFATLPQDLRSAVEQHWGPAPGDLFVDHG
FT                   TDPDGEIVLAAVTAGNVVILIQPPRGFGQNPIAIYHDPDLPPSHHYLAVYHWLRNGQDA
FT                   AGFGAHAVVHVGKHGNLEWLPGKAAALSASCAPDAALGDLPLVYPFLVNDPGEGTQAKR
FT                   RAHATVIDHLVPPMARADSYGDIARLERLLDEHAQIAAMDPAKLPAIRAQIWTLIEAAK
FT                   LDHDLGLTNRPHDAEFDEFILHVDGWLCEIKDAQIRDGLHVLGAAPTGDARVNLVLSML
FT                   RARQLWGGAVALPGLRQALGLGSEEGTTRTDAVEAVARELLTELDDRDWDPAAVDEVVA
FT                   EVLGVPAETDAIDRAPDDPDLVDRAAVAAVLTFAATEIVPRLARTTDEIDRTLHALAGG
FT                   FIPAGPSGSPLRGLVNVLPTGRNFYAVDPRAVPSPLAWETGRAMADSLLARHLADTGEY
FT                   PRSVGLSAWGTSAMRTSGDDVAEILALLGVTPLWDEASRRVRGVEPIPLAELGRPRIDV
FT                   TVRISGFFRDAFPHVVDLLDDAIRLVADLDEAPEDNYVRAHADADAATHGDRRRATTRI
FT                   FGSKPGAYGAGLLPLVDSGTWHDDADLAEVYAAWGGFAYGRGLAGRPARDDMTAAYRRI
FT                   SVAVKNTDSLEHDIADSDDYFQYHGGMIATVRALTGRGPRAYIGDSTRPDEVRTRTLGE
FT                   EMARVVRARVVNPRWISSMRRHGYKGAFELAATVDYLFGYDATAGVVADWMYEAVTEAY
FT                   VLDEENQKFLTDSNPWALHGIAERLLEAVDRGLWSAPRPETLDALREVYLRAEGDLEGR
FT                   A"
     MILLLSTSDT DLSCARACGE DYRLGNPARL DVADLPGLLD GVDVVVLRLL GGRRAWPEGV        60
     DALLARGLPV VVLSGELIPD AELMELSSVP AGVSAQAHAY LAHGGPDNLR QLARFLSDAL       120
     LLTGLGFDPP VPTPAWGLRP RPDTAAPDER PTVAILYYRA HELAGNTAFV DALADAVDAA       180
     GGRAVPVFCA SLRTADTELL AELGRAATLV TTVLAAGGAA LGAIPAEVGA GGRDEDWDIG       240
     ALAALDVPIL QALAVTSSRE QWEASDDGLS PLDTATQVAI PEFDGRIITV PFSFKEIDAD       300
     GLSRYVPDPE RAARVAGLAV RHARLRHVAN ADKRIALVLS AYPTKHARIG NAVGLDTPAS       360
     VLALLGALRE AGYDVGPETG PGALPGLEAG DGDAFIHGLI AAGGQDEDWL TAEHLAGNPV       420
     RVPAAVYRSW FATLPQDLRS AVEQHWGPAP GDLFVDHGTD PDGEIVLAAV TAGNVVILIQ       480
     PPRGFGQNPI AIYHDPDLPP SHHYLAVYHW LRNGQDAAGF GAHAVVHVGK HGNLEWLPGK       540
     AAALSASCAP DAALGDLPLV YPFLVNDPGE GTQAKRRAHA TVIDHLVPPM ARADSYGDIA       600
     RLERLLDEHA QIAAMDPAKL PAIRAQIWTL IEAAKLDHDL GLTNRPHDAE FDEFILHVDG       660
     WLCEIKDAQI RDGLHVLGAA PTGDARVNLV LSMLRARQLW GGAVALPGLR QALGLGSEEG       720
     TTRTDAVEAV ARELLTELDD RDWDPAAVDE VVAEVLGVPA ETDAIDRAPD DPDLVDRAAV       780
     AAVLTFAATE IVPRLARTTD EIDRTLHALA GGFIPAGPSG SPLRGLVNVL PTGRNFYAVD       840
     PRAVPSPLAW ETGRAMADSL LARHLADTGE YPRSVGLSAW GTSAMRTSGD DVAEILALLG       900
     VTPLWDEASR RVRGVEPIPL AELGRPRIDV TVRISGFFRD AFPHVVDLLD DAIRLVADLD       960
     EAPEDNYVRA HADADAATHG DRRRATTRIF GSKPGAYGAG LLPLVDSGTW HDDADLAEVY      1020
     AAWGGFAYGR GLAGRPARDD MTAAYRRISV AVKNTDSLEH DIADSDDYFQ YHGGMIATVR      1080
     ALTGRGPRAY IGDSTRPDEV RTRTLGEEMA RVVRARVVNP RWISSMRRHG YKGAFELAAT      1140
     VDYLFGYDAT AGVVADWMYE AVTEAYVLDE ENQKFLTDSN PWALHGIAER LLEAVDRGLW      1200
     SAPRPETLDA LREVYLRAEG DLEGRA                                           1226
//

If you have problems or comments...

PBIL Back to PBIL home page