(data stored in ACNUC7421 zone)

EMBL: CP002299.PE479

CP002299.PE479       Location/Qualifiers
FT   CDS             588835..589677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0484"
FT                   /product="putative esterase lipoprotein"
FT                   /note="KEGG: mbt:JTY_3323 putative esterase lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78567"
FT                   /db_xref="GOA:E3JA05"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA05"
FT                   /inference="similar to AA sequence:KEGG:JTY_3323"
FT                   /protein_id="ADP78567.1"
FT                   /translation="MTRRLVVDGRTRTFTLHRPAAAPAGRLLPVVLAFHGGFGNGSGMA
FT                   GLTHLDAVADQNGFLAVYPDGYQRSWNDGRGSTPADRAGVDDVAFVAALIDELVRDERA
FT                   DPRRVYATGISNGGIFTERLGCELADRLAAIAPVAGPMPADLVAGCRPARPIGVLEIHG
FT                   TADPIVPYSGGHVNGRGGGGQVASVAATGELWRRLDGCAAQPDVRPVADRVSDGTHLSV
FT                   ATAVGCPDGVGVVVDSFTGAGHTWPSGRQYLPKALIGRTSRQLDASRAIWAFFADYHR"
     MTRRLVVDGR TRTFTLHRPA AAPAGRLLPV VLAFHGGFGN GSGMAGLTHL DAVADQNGFL        60
     AVYPDGYQRS WNDGRGSTPA DRAGVDDVAF VAALIDELVR DERADPRRVY ATGISNGGIF       120
     TERLGCELAD RLAAIAPVAG PMPADLVAGC RPARPIGVLE IHGTADPIVP YSGGHVNGRG       180
     GGGQVASVAA TGELWRRLDG CAAQPDVRPV ADRVSDGTHL SVATAVGCPD GVGVVVDSFT       240
     GAGHTWPSGR QYLPKALIGR TSRQLDASRA IWAFFADYHR                             280
//

If you have problems or comments...

PBIL Back to PBIL home page