(data stored in ACNUC7421 zone)

EMBL: CP002299.PE480

CP002299.PE480       Location/Qualifiers
FT   CDS             complement(589693..590928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mva:Mvan_2552 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78568"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA06"
FT                   /inference="similar to AA sequence:KEGG:Mvan_2552"
FT                   /protein_id="ADP78568.1"
FT                   /translation="MTEPQVEPAPDPASVSTEDELRAAVLALLGDSYDRAVERRTGLSK
FT                   TTVNDVRNERRRLTAKTLTLIVEAYDPHRRDVWLAAWRRVRTRSERAGASLAADDDAHP
FT                   AGPGDGLAGTDTDADPIAAAEANLAGVTGGSPLLDGSRGGAGMGQPAGPGRSGSGPWRT
FT                   VSLAAGIALVASAGAALITYFAVRGDAAPPSAPVATNAAPAGGPGPVLPGQAPPLGPGG
FT                   PGAAWPVGGIGPPRIDQSPAARGPAPVARGCYSLPLQTRADVVAQSGADAAGLRVTELR
FT                   YTYYPAWHPSLAFGGRLSGPVPRSSRLVFAAWADPSTTDSTRDHNRGNGRFYPGDDLPT
FT                   TDENCFTVPPYNLSYGGYPGITTRLYAMLVDATDVKPFLRAAGQSAGLTDTDLARLGIR
FT                   ILGYAVVPSKPE"
     MTEPQVEPAP DPASVSTEDE LRAAVLALLG DSYDRAVERR TGLSKTTVND VRNERRRLTA        60
     KTLTLIVEAY DPHRRDVWLA AWRRVRTRSE RAGASLAADD DAHPAGPGDG LAGTDTDADP       120
     IAAAEANLAG VTGGSPLLDG SRGGAGMGQP AGPGRSGSGP WRTVSLAAGI ALVASAGAAL       180
     ITYFAVRGDA APPSAPVATN AAPAGGPGPV LPGQAPPLGP GGPGAAWPVG GIGPPRIDQS       240
     PAARGPAPVA RGCYSLPLQT RADVVAQSGA DAAGLRVTEL RYTYYPAWHP SLAFGGRLSG       300
     PVPRSSRLVF AAWADPSTTD STRDHNRGNG RFYPGDDLPT TDENCFTVPP YNLSYGGYPG       360
     ITTRLYAMLV DATDVKPFLR AAGQSAGLTD TDLARLGIRI LGYAVVPSKP E                411
//

If you have problems or comments...

PBIL Back to PBIL home page