(data stored in ACNUC7421 zone)

EMBL: CP002299.PE482

CP002299.PE482       Location/Qualifiers
FT   CDS             complement(592631..594118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0487"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   sma:SAV_1211 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78570"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR021295"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA08"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADP78570.1"
FT                   /translation="MRCVVVGATGYIGSRLIPELLARGHTVRAAARRPDRLAGAPWLDQ
FT                   VDLVTADVGDPGQVAAALAGQDVLYYLVHSLHQRDFVERDRAAAQTVARAAREAGVRRI
FT                   IYLGGISPAGQRLSAHLASREEVGLTLLGSGVPTVVLRAAVVIGSGSASFEMLRYLTER
FT                   LPAMVTPRWVRSRVQPIAVRDVLYYLTRTAELVPAEVNRGFDIGGPDVLTYWEMMRRYA
FT                   TVAGLPRRVVVPVPLLTPWLSAQWVNLVTPVPRSIAVPLISSLVHEVVCRDHDLAAYVP
FT                   DPASGLTGYDDAVALALARTREADVPSRWARATTPRTRSLPPSDPLPTDPDWSGGTVYQ
FT                   DVRELATAADPTRLWQVIETVGAENGRHVIPAARAVAARPGRVTRSAEALRRRLVRPAG
FT                   AADAPLSGWRVEDAERPRRLRLRAQLRLPGRAWLELSAAPAAQGSVYRQRAIFEPHGLL
FT                   GQLCWKSFAPVRGLVLGRMAHTVAAAAERPAPVGQPW"
     MRCVVVGATG YIGSRLIPEL LARGHTVRAA ARRPDRLAGA PWLDQVDLVT ADVGDPGQVA        60
     AALAGQDVLY YLVHSLHQRD FVERDRAAAQ TVARAAREAG VRRIIYLGGI SPAGQRLSAH       120
     LASREEVGLT LLGSGVPTVV LRAAVVIGSG SASFEMLRYL TERLPAMVTP RWVRSRVQPI       180
     AVRDVLYYLT RTAELVPAEV NRGFDIGGPD VLTYWEMMRR YATVAGLPRR VVVPVPLLTP       240
     WLSAQWVNLV TPVPRSIAVP LISSLVHEVV CRDHDLAAYV PDPASGLTGY DDAVALALAR       300
     TREADVPSRW ARATTPRTRS LPPSDPLPTD PDWSGGTVYQ DVRELATAAD PTRLWQVIET       360
     VGAENGRHVI PAARAVAARP GRVTRSAEAL RRRLVRPAGA ADAPLSGWRV EDAERPRRLR       420
     LRAQLRLPGR AWLELSAAPA AQGSVYRQRA IFEPHGLLGQ LCWKSFAPVR GLVLGRMAHT       480
     VAAAAERPAP VGQPW                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page