(data stored in ACNUC7421 zone)

EMBL: CP002299.PE483

CP002299.PE483       Location/Qualifiers
FT   CDS             594286..595533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0488"
FT                   /product="diguanylate phosphodiesterase with GAF sensor(s)"
FT                   /note="KEGG: fal:FRAAL3871 regulatory protein; PFAM: EAL
FT                   domain protein; GAF domain protein; SMART: EAL domain
FT                   protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78571"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA09"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ADP78571.1"
FT                   /translation="MVGTVESGARVIEPDRKVTDLLDVLRQHLGMDVAALAIWQDRQLV
FT                   VQLFAGDGRSFGLVPGITIRNGGELYRDVQDERIPMVSGNAHGYARARHSSALDELDVG
FT                   AYAMTTLTDGRDEPYGLLFCLTHEACPTLQERHQQFVQLIATFLRDSLLDLREMWQTRS
FT                   QIWSAISDVIDSGGPGMAFQPIVRLDTGEVGAVEALARFSARSGGRIRTTEEWFRDARL
FT                   VGLSTELDLAAIRRAVAVIPDLPPGLKLAVNASPSTVATVLGEFVKDLPHRDRLIIEIT
FT                   EHENYTAGPETVLAVGHLRDLGVRIAIDDAGTGYSGLEKLVLLRPDVIKIDQVLTRGID
FT                   VDPARRALTAGLVALAGEIGGTVIAEGIETRTERDAMLRSGVHYGQGYYLGMPSPSLVP
FT                   RTPAWVGVGPSWRRAP"
     MVGTVESGAR VIEPDRKVTD LLDVLRQHLG MDVAALAIWQ DRQLVVQLFA GDGRSFGLVP        60
     GITIRNGGEL YRDVQDERIP MVSGNAHGYA RARHSSALDE LDVGAYAMTT LTDGRDEPYG       120
     LLFCLTHEAC PTLQERHQQF VQLIATFLRD SLLDLREMWQ TRSQIWSAIS DVIDSGGPGM       180
     AFQPIVRLDT GEVGAVEALA RFSARSGGRI RTTEEWFRDA RLVGLSTELD LAAIRRAVAV       240
     IPDLPPGLKL AVNASPSTVA TVLGEFVKDL PHRDRLIIEI TEHENYTAGP ETVLAVGHLR       300
     DLGVRIAIDD AGTGYSGLEK LVLLRPDVIK IDQVLTRGID VDPARRALTA GLVALAGEIG       360
     GTVIAEGIET RTERDAMLRS GVHYGQGYYL GMPSPSLVPR TPAWVGVGPS WRRAP            415
//

If you have problems or comments...

PBIL Back to PBIL home page