(data stored in ACNUC7421 zone)

EMBL: CP002299.PE485

CP002299.PE485       Location/Qualifiers
FT   CDS             complement(596540..597508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0490"
FT                   /product="sugar isomerase (SIS)"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: msm:MSMEG_5330
FT                   SIS domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78573"
FT                   /db_xref="GOA:E3JA11"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA11"
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /protein_id="ADP78573.1"
FT                   /translation="MDAELFQADLEAKPARLRELSAQLGHLWAGVDTDRPILLLGMGSS
FT                   HYAGGVVAARLRAAGTPAVAEIASNDLLPRPRPGTLVIAVSASGGSTETLDAVRRLRDA
FT                   DPGGAVTFVALTNRAGSELESSCDVAVPMLAGTELGGVACRSFQHTLATLLALPALAGR
FT                   TPWPETVGKAAEATEDLLARRDTWLATTAELLLGPHGTHVAAPARRLSSAQQSALMLRE
FT                   GPRLPAVACETGDWSHVDVYLTKTTDYRLLLCGGSRWEPELFRWTKERGSTVVAVGAPA
FT                   PDAAYTLRYRHDEDDGVRLLTETLVAELLAADAWRRSAATA"
     MDAELFQADL EAKPARLREL SAQLGHLWAG VDTDRPILLL GMGSSHYAGG VVAARLRAAG        60
     TPAVAEIASN DLLPRPRPGT LVIAVSASGG STETLDAVRR LRDADPGGAV TFVALTNRAG       120
     SELESSCDVA VPMLAGTELG GVACRSFQHT LATLLALPAL AGRTPWPETV GKAAEATEDL       180
     LARRDTWLAT TAELLLGPHG THVAAPARRL SSAQQSALML REGPRLPAVA CETGDWSHVD       240
     VYLTKTTDYR LLLCGGSRWE PELFRWTKER GSTVVAVGAP APDAAYTLRY RHDEDDGVRL       300
     LTETLVAELL AADAWRRSAA TA                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page