(data stored in ACNUC7421 zone)

EMBL: CP002299.PE486

CP002299.PE486       Location/Qualifiers
FT   CDS             complement(597508..598686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0491"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   sro:Sros_1800 uncharacterized protein probably involved in
FT                   trehalose biosynthesis-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78574"
FT                   /db_xref="GOA:E3JA12"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA12"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADP78574.1"
FT                   /translation="MADGSPTLPLVVELVDGAWRARPSGPGAGVALLALLRSDGDVPDG
FT                   FRITRGVSRPFEPTERRVTADQTNESWIIGEAAVVKWTTQPLVGPDPERLRRLVAAGFS
FT                   RTPALWGMIEWRTPDGHWVPVATVNDLVPGAEDGWTWCVDEARHALAALDPPAAAPVPR
FT                   GDEGDGRVGRPFGAELGALTAAMHLALADRTPATASPDEALSWLEAAEDLLGQVSSPLL
FT                   DAHRDSIAAALGPLGQAAGTPLVAAHGDFHVGQLLRAPGGPLFVIDFDGNPTLTPRQRR
FT                   APQPAALDVAGMLLSLENVGHVVCHHNPEVPAAAAATWTASVQAEFLDSYRAGLGSAGR
FT                   GDLLDESLLEAYGWQQLCRELAYADRHLPRWRYVPEAALRRRFPPPAGPEDA"
     MADGSPTLPL VVELVDGAWR ARPSGPGAGV ALLALLRSDG DVPDGFRITR GVSRPFEPTE        60
     RRVTADQTNE SWIIGEAAVV KWTTQPLVGP DPERLRRLVA AGFSRTPALW GMIEWRTPDG       120
     HWVPVATVND LVPGAEDGWT WCVDEARHAL AALDPPAAAP VPRGDEGDGR VGRPFGAELG       180
     ALTAAMHLAL ADRTPATASP DEALSWLEAA EDLLGQVSSP LLDAHRDSIA AALGPLGQAA       240
     GTPLVAAHGD FHVGQLLRAP GGPLFVIDFD GNPTLTPRQR RAPQPAALDV AGMLLSLENV       300
     GHVVCHHNPE VPAAAAATWT ASVQAEFLDS YRAGLGSAGR GDLLDESLLE AYGWQQLCRE       360
     LAYADRHLPR WRYVPEAALR RRFPPPAGPE DA                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page