(data stored in ACNUC7421 zone)

EMBL: CP002299.PE492

CP002299.PE492       Location/Qualifiers
FT   CDS             complement(605302..605658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0497"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; Domain of
FT                   unknown function DUF35, rubredoxin-like zinc ribbon
FT                   domain-like; KEGG: mpa:MAP3114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78580"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA18"
FT                   /inference="protein motif:PFAM:PF01796"
FT                   /protein_id="ADP78580.1"
FT                   /translation="MTTSRLDAGDRLLVQRCLACERWTYPEAARCSACGGELGVEPVSG
FT                   DGTVFTFTVNHHPFHPTLPVPYVIAVVQLAEQDDLRVVGNIVGCAPEDVAVGMTVRAAF
FT                   ERHGDAVRQDFRKR"
     MTTSRLDAGD RLLVQRCLAC ERWTYPEAAR CSACGGELGV EPVSGDGTVF TFTVNHHPFH        60
     PTLPVPYVIA VVQLAEQDDL RVVGNIVGCA PEDVAVGMTV RAAFERHGDA VRQDFRKR         118
//

If you have problems or comments...

PBIL Back to PBIL home page