(data stored in ACNUC7421 zone)

EMBL: CP002299.PE494

CP002299.PE494       Location/Qualifiers
FT   CDS             complement(607090..610905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0499"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hmu:Hmuk_2419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78582"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA20"
FT                   /inference="similar to AA sequence:KEGG:Hmuk_2419"
FT                   /protein_id="ADP78582.1"
FT                   /translation="MSDAVAFNTGLPLAADLRTHLLSQLGAEEEWIGPGPDGTGLLWRH
FT                   SELGTLLELLPVPDGASAVAVLRVTTPVSTIGDPARARALCQRLNAEITLNRWIAGPWP
FT                   AIPDRPDPDADEDEDDEAADHPSLADDPTQPTARVEPAGTIPPATKAKAGPTAEASPEA
FT                   GAAATGADGGPEAETATATEARPEAETGTEAEPGTGAEAGTEPGAPARSADLDLSDRLA
FT                   LEAFLDESTDLDPDALYLSCSFVVGRLEQGDDDEDEDDDPDEDSDDEADDTAPGGAALA
FT                   RLAVAAVGDQIATAVAALGDGLHDEVAGVPFVARDADGEARPGRHRVTRYHDLLHAGAE
FT                   ADNTPLWRALLAAFDGLRYDQESDGGPVWGAGDGRGFRCEVPFSWGPFFTPEDRPVEVV
FT                   TAPEPAPAGLLTSVVLASRQDPRPEAGEGLLITMRTPVTVRPSDDVAGVLTALNIQDAR
FT                   DPGAAHGVGAWVLRGGAPTWTVFLPNAVMAAGTRTTVTLLREVLLAAAGASMLARRVLL
FT                   TGEDLTPADRYPIGPASRRPAGLAFAASSTACDEPALALDALYASLVGPDVEWSVLGSA
FT                   GFDWWPYQGRQRLRVTPRPAPDDRRAGSLRISTEVASKVPASPDVLRLLARRNADDGRS
FT                   ALVLDPVAGTVEAVARVHLGPSLWSPDRSWARLVAVDQLIRADEAASALVGLGGPARGA
FT                   VPAGSAHPTNGPRPSRDILFDALPDIRLGAQEAMNGDDAVRPLVLPITLTALMAPPHRV
FT                   TGHEPGRTLTAEWWTRTYDPSGPAARCRSELTVTDHQDLGLGIRVRTCLDYLPGDVDER
FT                   AAWCNDRNRALLAETSADDLTVVGGWGLDATDAPCLTTWFFPETMLGDHPDEIAGALGR
FT                   LVRYQQWIVFVSLADSPVAPLSDTRTVAELAAGLPSLFGAFRAVLDYPAGLSLTAATPV
FT                   GDDARSETVVVEWTRPVTPPVHEELMSWPRLAEPISEPSRPRLVTRLDAPLDGLRGPLA
FT                   LLLTALAAGSRTWLPDLSVPPDPGRPGAKPLTVPGHLGNAFRDAHVRDALGRLLFDGQI
FT                   ADDGHGTGFLVLAEPLAPGEQGETQPASRSEASATGSLDTADGEASGFGLGADPEFSFT
FT                   ADDEVGLGRRAPATIARLAPPTPGDHPFYGAGTMILDTHLDPGLLRPGDLERLGELSRM
FT                   GQLDRLGTFDDAGVPSGAGRPADDAELTAALIAISTLAPAQTCGAWIAHEKSGTLAYRI
FT                   CLPPSCLLWPAPEAVGSIVDAAWRVAIAQVRAAAHLLSAQAMSPGA"
     MSDAVAFNTG LPLAADLRTH LLSQLGAEEE WIGPGPDGTG LLWRHSELGT LLELLPVPDG        60
     ASAVAVLRVT TPVSTIGDPA RARALCQRLN AEITLNRWIA GPWPAIPDRP DPDADEDEDD       120
     EAADHPSLAD DPTQPTARVE PAGTIPPATK AKAGPTAEAS PEAGAAATGA DGGPEAETAT       180
     ATEARPEAET GTEAEPGTGA EAGTEPGAPA RSADLDLSDR LALEAFLDES TDLDPDALYL       240
     SCSFVVGRLE QGDDDEDEDD DPDEDSDDEA DDTAPGGAAL ARLAVAAVGD QIATAVAALG       300
     DGLHDEVAGV PFVARDADGE ARPGRHRVTR YHDLLHAGAE ADNTPLWRAL LAAFDGLRYD       360
     QESDGGPVWG AGDGRGFRCE VPFSWGPFFT PEDRPVEVVT APEPAPAGLL TSVVLASRQD       420
     PRPEAGEGLL ITMRTPVTVR PSDDVAGVLT ALNIQDARDP GAAHGVGAWV LRGGAPTWTV       480
     FLPNAVMAAG TRTTVTLLRE VLLAAAGASM LARRVLLTGE DLTPADRYPI GPASRRPAGL       540
     AFAASSTACD EPALALDALY ASLVGPDVEW SVLGSAGFDW WPYQGRQRLR VTPRPAPDDR       600
     RAGSLRISTE VASKVPASPD VLRLLARRNA DDGRSALVLD PVAGTVEAVA RVHLGPSLWS       660
     PDRSWARLVA VDQLIRADEA ASALVGLGGP ARGAVPAGSA HPTNGPRPSR DILFDALPDI       720
     RLGAQEAMNG DDAVRPLVLP ITLTALMAPP HRVTGHEPGR TLTAEWWTRT YDPSGPAARC       780
     RSELTVTDHQ DLGLGIRVRT CLDYLPGDVD ERAAWCNDRN RALLAETSAD DLTVVGGWGL       840
     DATDAPCLTT WFFPETMLGD HPDEIAGALG RLVRYQQWIV FVSLADSPVA PLSDTRTVAE       900
     LAAGLPSLFG AFRAVLDYPA GLSLTAATPV GDDARSETVV VEWTRPVTPP VHEELMSWPR       960
     LAEPISEPSR PRLVTRLDAP LDGLRGPLAL LLTALAAGSR TWLPDLSVPP DPGRPGAKPL      1020
     TVPGHLGNAF RDAHVRDALG RLLFDGQIAD DGHGTGFLVL AEPLAPGEQG ETQPASRSEA      1080
     SATGSLDTAD GEASGFGLGA DPEFSFTADD EVGLGRRAPA TIARLAPPTP GDHPFYGAGT      1140
     MILDTHLDPG LLRPGDLERL GELSRMGQLD RLGTFDDAGV PSGAGRPADD AELTAALIAI      1200
     STLAPAQTCG AWIAHEKSGT LAYRICLPPS CLLWPAPEAV GSIVDAAWRV AIAQVRAAAH      1260
     LLSAQAMSPG A                                                           1271
//

If you have problems or comments...

PBIL Back to PBIL home page