(data stored in ACNUC7421 zone)

EMBL: CP002299.PE496

CP002299.PE496       Location/Qualifiers
FT   CDS             complement(612339..615752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0501"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="KEGG: fal:FRAAL3851 putative serine/threonine
FT                   protein kinase; PFAM: Serine/threonine-protein kinase-like
FT                   domain; PASTA domain containing protein; SMART:
FT                   serine/threonine protein kinase; Tyrosine-protein kinase,
FT                   catalytic domain; PASTA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78584"
FT                   /db_xref="GOA:E3JA22"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA22"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADP78584.1"
FT                   /translation="MAGGGLPASRCQGLSDVSGIRQKTTKLSPGASSQWDARPSDISLV
FT                   NGGDVDSRGGASRALARPPARATQLPGSPLRPSDPRELDGYQLLRRLGEGGMGTVYLGR
FT                   SPTGRRVAVKIVRAELADDPEYRARFRREAEVARRVARYCTAEVLDAVDPPDGAPYLVT
FT                   EFVDGPPLSQTVSRRGPLGSADVERVAVSVASALTVIHAAGLVHRDLKPSNVLLSQFGP
FT                   RVIDFGVAWAPDSVAVTRDLVVGTPAFMAPEQARGQRVTSAADIFSWGGLIIFAATGRR
FT                   PFGGGAVPAVLYRIVNSDPDLDGLDEGLTEVVRDAMRRDPAERPTAAEIVNRLQALSTI
FT                   RATTPIWVTPPASEPVAAESGALAQAGTAANGAEPNGAAPAADSAGTDAAGSDAASSGA
FT                   AEPVTPADGSGGGLGEDAPAVNAGAAGESAASAESEADAGSSAGAEAAATGVPAADGTD
FT                   AASSDTSDAGAGTPAAGVVSAAAAQDGTDPAANADQAGTGAGSAARTGTAAGSPGADAA
FT                   EDGSQGDSSVGDSSLGDGTLGDGASAADAGAHVSATADDSQGPADDAVSEPGADMAGDD
FT                   EDPPTVGSGPIPVAGLNDDFTFGDLSVWGDDGTELTVGYLARLGSVGEELDDSDDHGFR
FT                   DLDYTDFDSASGLDSDGLEYADFDDGSGGVNRISQRTVTLRGDSPRGPGRTLETLSLNG
FT                   LDDSGRSTWPPPRRRGPLAALARWFPGFAPGGRIPWTTVISAFSVIVALAAVGVAAAAA
FT                   VDSSGRSANATLAAQLTIPNNLVGLSVKEAEARLHAAGFAHLQFEMTPDLKPKGTVLSV
FT                   QPGEGIEIEASDTVTLVVSAGLDSVKIPQVVGLTDSAARSNLQDAGLTVVVRSISGPAS
FT                   VSPGHVAAIFPAAGVEVPPGSSVTILVVVPAGTKSLASVPNVIGMTTNDAQDALHKAGF
FT                   TDIAISSVAASEPAGTVTASDPAANTTTAKNATVTLTVSTGPGQTAVPDVAGRTQADAE
FT                   AALAQAGLVATVRQDPGPSTITAGLVETVDPAPGSKVPVHAEVTITVVSTQVAMPDARG
FT                   RQRADAERLLTSYGLTVTVTQQSSSAAPGTVLTQSTTPGAMIGRGSNVTLVVAKAADSP
FT                   TSPPTSPSPPPTSPPPTGPTSPSPPASATA"
     MAGGGLPASR CQGLSDVSGI RQKTTKLSPG ASSQWDARPS DISLVNGGDV DSRGGASRAL        60
     ARPPARATQL PGSPLRPSDP RELDGYQLLR RLGEGGMGTV YLGRSPTGRR VAVKIVRAEL       120
     ADDPEYRARF RREAEVARRV ARYCTAEVLD AVDPPDGAPY LVTEFVDGPP LSQTVSRRGP       180
     LGSADVERVA VSVASALTVI HAAGLVHRDL KPSNVLLSQF GPRVIDFGVA WAPDSVAVTR       240
     DLVVGTPAFM APEQARGQRV TSAADIFSWG GLIIFAATGR RPFGGGAVPA VLYRIVNSDP       300
     DLDGLDEGLT EVVRDAMRRD PAERPTAAEI VNRLQALSTI RATTPIWVTP PASEPVAAES       360
     GALAQAGTAA NGAEPNGAAP AADSAGTDAA GSDAASSGAA EPVTPADGSG GGLGEDAPAV       420
     NAGAAGESAA SAESEADAGS SAGAEAAATG VPAADGTDAA SSDTSDAGAG TPAAGVVSAA       480
     AAQDGTDPAA NADQAGTGAG SAARTGTAAG SPGADAAEDG SQGDSSVGDS SLGDGTLGDG       540
     ASAADAGAHV SATADDSQGP ADDAVSEPGA DMAGDDEDPP TVGSGPIPVA GLNDDFTFGD       600
     LSVWGDDGTE LTVGYLARLG SVGEELDDSD DHGFRDLDYT DFDSASGLDS DGLEYADFDD       660
     GSGGVNRISQ RTVTLRGDSP RGPGRTLETL SLNGLDDSGR STWPPPRRRG PLAALARWFP       720
     GFAPGGRIPW TTVISAFSVI VALAAVGVAA AAAVDSSGRS ANATLAAQLT IPNNLVGLSV       780
     KEAEARLHAA GFAHLQFEMT PDLKPKGTVL SVQPGEGIEI EASDTVTLVV SAGLDSVKIP       840
     QVVGLTDSAA RSNLQDAGLT VVVRSISGPA SVSPGHVAAI FPAAGVEVPP GSSVTILVVV       900
     PAGTKSLASV PNVIGMTTND AQDALHKAGF TDIAISSVAA SEPAGTVTAS DPAANTTTAK       960
     NATVTLTVST GPGQTAVPDV AGRTQADAEA ALAQAGLVAT VRQDPGPSTI TAGLVETVDP      1020
     APGSKVPVHA EVTITVVSTQ VAMPDARGRQ RADAERLLTS YGLTVTVTQQ SSSAAPGTVL      1080
     TQSTTPGAMI GRGSNVTLVV AKAADSPTSP PTSPSPPPTS PPPTGPTSPS PPASATA         1137
//

If you have problems or comments...

PBIL Back to PBIL home page