(data stored in ACNUC7421 zone)

EMBL: CP002299.PE497

CP002299.PE497       Location/Qualifiers
FT   CDS             complement(615812..616204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0502"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: stp:Strop_2027
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78585"
FT                   /db_xref="GOA:E3JA23"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA23"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADP78585.1"
FT                   /translation="MKLAQVMVLVDEYDPAIVFFTEVLGFELVEDSPATTNDGRPKRWV
FT                   VVRPPGAETSILLARADGPAQSAAVGHQAAGRVGFFLHVDDFEASYQRMLAANVTFLGE
FT                   PRDEPYGRVVVFLDLAGNRWDMIQPA"
     MKLAQVMVLV DEYDPAIVFF TEVLGFELVE DSPATTNDGR PKRWVVVRPP GAETSILLAR        60
     ADGPAQSAAV GHQAAGRVGF FLHVDDFEAS YQRMLAANVT FLGEPRDEPY GRVVVFLDLA       120
     GNRWDMIQPA                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page