(data stored in ACNUC7421 zone)

EMBL: CP002299.PE499

CP002299.PE499       Location/Qualifiers
FT   CDS             complement(617140..620079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0504"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78587"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E3JA25"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6441"
FT                   /protein_id="ADP78587.1"
FT                   /translation="MTRTPRSGPPAPSSAGPVGTPGSSGLAGLGPLAGPAAAPGDEHAE
FT                   QNGGPRDEPAPSGRARRLTSIAAALALVAVGGAAALGRGSHSVALTLSDGGGWLASERL
FT                   GLLFHVNGPSGQADAAVTLPGAAGHPLTVLTGFARPAAAAPTDAAPSGPAGTRPSASAT
FT                   TPTPSAAAARAPGAAATGAAADLGAGWPSDQAEAVIVVDDLAGTVWLVDPSLLTISASV
FT                   ALPPGAVVLAAAGDAYAVDAATGRVIRLDPRTLAQLGAPITFPAGLGTAAQTPDGTLWV
FT                   PVASAGTVVPVRAGTPGTPVPVAPAGDRLDVTTVAGSAVVVDQTAGTVVRLAMDHADAA
FT                   IRLPDAPATSGAAARLLLPTSTDGQVLALAQPANGELLLADLATGRVSTTTLPAVGAAD
FT                   VDVSALAAATGTGTGAGHQVGAPVSHDGQVYVPDSNAGVVWDFDPKTARFAAPVPVAPV
FT                   GTPSRISLDVQSGQLWINDETGPTVVLVNGASRRTLLKFGAALPGGLRTNTPRPLPPGP
FT                   TPTASQSSSQGGGTGAGGTGSGGRPGLIWPGWTPSSRPGTRGDGGGRADGTGRGTGGRG
FT                   DDRTGAGNGRGGGQPGGQTGEPTGNRPTGPGQPEPPASNTAAPPQPEPTAGQQTPGEPT
FT                   GSGGPGGGQTGGTDQAGAGGGVGTGGSQAASGAGVDGQSPNQAGDGAPGPADPPAAQPT
FT                   TAPAPTGPPSGSAGAPGHPTGPATPTPSPGHAPTPPDQGSPRPPGFWLLTADGTVLARG
FT                   TAQAVASTGADPGAVAIAPTATGRGYWLVDATGAGRPVGDAPAVPAAAGTGTVVAAAAG
FT                   PTGGGYWTVTATGTVVPHGTLTGYGSLLSAPGAPVVGIAATPTGGGYWLLDAAGGVYPF
FT                   GDAEAIAPGAQPTGPATGPQRSVGIAASPTGAGYWTVTAAGLVSAHGGAGGYGSASGSS
FT                   TVVGIAATPSGRGYWLLDTAGGAQAFGDAITTGATAAAGTRVIAVAAAP"
     MTRTPRSGPP APSSAGPVGT PGSSGLAGLG PLAGPAAAPG DEHAEQNGGP RDEPAPSGRA        60
     RRLTSIAAAL ALVAVGGAAA LGRGSHSVAL TLSDGGGWLA SERLGLLFHV NGPSGQADAA       120
     VTLPGAAGHP LTVLTGFARP AAAAPTDAAP SGPAGTRPSA SATTPTPSAA AARAPGAAAT       180
     GAAADLGAGW PSDQAEAVIV VDDLAGTVWL VDPSLLTISA SVALPPGAVV LAAAGDAYAV       240
     DAATGRVIRL DPRTLAQLGA PITFPAGLGT AAQTPDGTLW VPVASAGTVV PVRAGTPGTP       300
     VPVAPAGDRL DVTTVAGSAV VVDQTAGTVV RLAMDHADAA IRLPDAPATS GAAARLLLPT       360
     STDGQVLALA QPANGELLLA DLATGRVSTT TLPAVGAADV DVSALAAATG TGTGAGHQVG       420
     APVSHDGQVY VPDSNAGVVW DFDPKTARFA APVPVAPVGT PSRISLDVQS GQLWINDETG       480
     PTVVLVNGAS RRTLLKFGAA LPGGLRTNTP RPLPPGPTPT ASQSSSQGGG TGAGGTGSGG       540
     RPGLIWPGWT PSSRPGTRGD GGGRADGTGR GTGGRGDDRT GAGNGRGGGQ PGGQTGEPTG       600
     NRPTGPGQPE PPASNTAAPP QPEPTAGQQT PGEPTGSGGP GGGQTGGTDQ AGAGGGVGTG       660
     GSQAASGAGV DGQSPNQAGD GAPGPADPPA AQPTTAPAPT GPPSGSAGAP GHPTGPATPT       720
     PSPGHAPTPP DQGSPRPPGF WLLTADGTVL ARGTAQAVAS TGADPGAVAI APTATGRGYW       780
     LVDATGAGRP VGDAPAVPAA AGTGTVVAAA AGPTGGGYWT VTATGTVVPH GTLTGYGSLL       840
     SAPGAPVVGI AATPTGGGYW LLDAAGGVYP FGDAEAIAPG AQPTGPATGP QRSVGIAASP       900
     TGAGYWTVTA AGLVSAHGGA GGYGSASGSS TVVGIAATPS GRGYWLLDTA GGAQAFGDAI       960
     TTGATAAAGT RVIAVAAAP                                                    979
//

If you have problems or comments...

PBIL Back to PBIL home page