(data stored in ACNUC7421 zone)

EMBL: CP002299.PE50

CP002299.PE50        Location/Qualifiers
FT   CDS             57180..58106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0050"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /note="PFAM: dTDP-4-dehydrorhamnose reductase; KEGG:
FT                   geo:Geob_2135 dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78138"
FT                   /db_xref="GOA:E3J3D6"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3D6"
FT                   /inference="protein motif:PFAM:PF04321"
FT                   /protein_id="ADP78138.1"
FT                   /translation="MRVLVLGGAGMLGHELASALAGRHDVGVTVHGPRPPRRRDRSDPW
FT                   AGALPANRIFAGLDVRCQDDLAGLLADFRPEAVVNAVGLVKQRPEGRTALPAVEINTVF
FT                   PHRLARLCRIAGVRMVHVSSDCVFSGRRGRYTEDDQPDPVDVYGMSKLLGEIREAPVVT
FT                   LRTSIIGLEPAGRGSGLVEWFLAQTGQVSGYRRAIYTGLTTMEFARVVDRLLTKHEDLT
FT                   GLWHVATAEAITKHELLTRLADRLRRAGGSRAVAEVVAAEGPACDRSLLADRFAEATGY
FT                   TAPGWDAMLDELVERITLRDDGGRRDG"
     MRVLVLGGAG MLGHELASAL AGRHDVGVTV HGPRPPRRRD RSDPWAGALP ANRIFAGLDV        60
     RCQDDLAGLL ADFRPEAVVN AVGLVKQRPE GRTALPAVEI NTVFPHRLAR LCRIAGVRMV       120
     HVSSDCVFSG RRGRYTEDDQ PDPVDVYGMS KLLGEIREAP VVTLRTSIIG LEPAGRGSGL       180
     VEWFLAQTGQ VSGYRRAIYT GLTTMEFARV VDRLLTKHED LTGLWHVATA EAITKHELLT       240
     RLADRLRRAG GSRAVAEVVA AEGPACDRSL LADRFAEATG YTAPGWDAML DELVERITLR       300
     DDGGRRDG                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page