(data stored in ACNUC7421 zone)

EMBL: CP002299.PE502

CP002299.PE502       Location/Qualifiers
FT   CDS             623525..626515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0507"
FT                   /product="transglutaminase domain-containing protein"
FT                   /note="KEGG: fal:FRAAL6437 hypothetical protein; PFAM:
FT                   transglutaminase domain-containing protein; SMART:
FT                   transglutaminase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78590"
FT                   /db_xref="GOA:E3JB60"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB60"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ADP78590.1"
FT                   /translation="MPAEPAARRATSLLLVVALALVDGWGFVRLFSAADLRLLVPVAAV
FT                   APVLLVVAASWGRRRPAPFALSALLWTVGFVLVAAALVTARAGGPVARLAEVRTGVLAG
FT                   PTRLLDVAVPAPGDADLLVVPFLVTWLAAALGAELVVRTRTRLLPAFPALLALLAATAA
FT                   AVPGQGSNLAPATALAAVAGLLVLVRRPAALTGTPASTGSAAPTGTAAPTGTAVPGTSA
FT                   GPGGLPDPGPRSTRLADGSAPGPAGGEATPSKPEDGLTPARPTRITLGPGRPSRPLAAA
FT                   RALGALTVVVAAAVTAGAVLPSAFAAGGPVDPRAYRATPADQVAGLNPLSALAGWTTRP
FT                   DDKLFTVRLTGQAAGPVPLRLAVLSDFDGANWTSSARYTRAGQTIPAGRDQPATGGAPV
FT                   TQELTVAGLTGTQLPTLDRPVQVGSATDAGLAADLADGLLLRTAPLTTGEHLTVVSRPA
FT                   PARAVAQLATLTSGTAATAEQDAEYLALPANVPPVLRALARVAAGQGTGPFQQAALLQH
FT                   YLATNFQFDPRVPPGHSLAHVEHFVADTRRGTSEQFATTFVLAARVLGLPARVVVGFTP
FT                   AAPAGAATVTVTGRQALAWAEVRFDGAGWLPFFPTPSAVDARGAALAGSTQGESDAQAA
FT                   LVDAAVRGPLAVPAAVNRPAATAATPSGRAGHLRGLVEWVAAGLGALAAGYVAVALARP
FT                   VARRRRRLSARRSPRERVVLAWEHAVDALLAVGVPVPVSASPAEVVQLGADAVGGERAD
FT                   GRRAGAAGAGASMSALRGLAHLATLALFGPDDGAGRTGAGAVLVAGATVMPVPVPVPGT
FT                   GPIPTHRHGPTHAAGRASRGLPAGRTGPLALPAGRTGPLALPPGRTGPLPLPSGRTGPL
FT                   RSGGTGMGPRSNGRTGPGPEPAANGRTGALALADGRRTGPFGLPAGRTGPLALPGGPGG
FT                   VEPSVAAGAGATGWDGVAGRRAADEARRLALTVEQAAWRSTPWRRRLTSRLSPRAVLTG
FT                   RWPSASG"
     MPAEPAARRA TSLLLVVALA LVDGWGFVRL FSAADLRLLV PVAAVAPVLL VVAASWGRRR        60
     PAPFALSALL WTVGFVLVAA ALVTARAGGP VARLAEVRTG VLAGPTRLLD VAVPAPGDAD       120
     LLVVPFLVTW LAAALGAELV VRTRTRLLPA FPALLALLAA TAAAVPGQGS NLAPATALAA       180
     VAGLLVLVRR PAALTGTPAS TGSAAPTGTA APTGTAVPGT SAGPGGLPDP GPRSTRLADG       240
     SAPGPAGGEA TPSKPEDGLT PARPTRITLG PGRPSRPLAA ARALGALTVV VAAAVTAGAV       300
     LPSAFAAGGP VDPRAYRATP ADQVAGLNPL SALAGWTTRP DDKLFTVRLT GQAAGPVPLR       360
     LAVLSDFDGA NWTSSARYTR AGQTIPAGRD QPATGGAPVT QELTVAGLTG TQLPTLDRPV       420
     QVGSATDAGL AADLADGLLL RTAPLTTGEH LTVVSRPAPA RAVAQLATLT SGTAATAEQD       480
     AEYLALPANV PPVLRALARV AAGQGTGPFQ QAALLQHYLA TNFQFDPRVP PGHSLAHVEH       540
     FVADTRRGTS EQFATTFVLA ARVLGLPARV VVGFTPAAPA GAATVTVTGR QALAWAEVRF       600
     DGAGWLPFFP TPSAVDARGA ALAGSTQGES DAQAALVDAA VRGPLAVPAA VNRPAATAAT       660
     PSGRAGHLRG LVEWVAAGLG ALAAGYVAVA LARPVARRRR RLSARRSPRE RVVLAWEHAV       720
     DALLAVGVPV PVSASPAEVV QLGADAVGGE RADGRRAGAA GAGASMSALR GLAHLATLAL       780
     FGPDDGAGRT GAGAVLVAGA TVMPVPVPVP GTGPIPTHRH GPTHAAGRAS RGLPAGRTGP       840
     LALPAGRTGP LALPPGRTGP LPLPSGRTGP LRSGGTGMGP RSNGRTGPGP EPAANGRTGA       900
     LALADGRRTG PFGLPAGRTG PLALPGGPGG VEPSVAAGAG ATGWDGVAGR RAADEARRLA       960
     LTVEQAAWRS TPWRRRLTSR LSPRAVLTGR WPSASG                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page