(data stored in ACNUC7421 zone)

EMBL: CP002299.PE503

CP002299.PE503       Location/Qualifiers
FT   CDS             complement(626545..627243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0508"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   tfu:Tfu_1544 putative enoyl-CoA hydratase/isomerase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78591"
FT                   /db_xref="GOA:E3JB61"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB61"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADP78591.1"
FT                   /translation="MPKLEHDGEVYVLDLGDGENRFTKDWLVEVEALLSEIEATDGPKA
FT                   LVTVARGKIWSNGLDLDWMIAHTDELTDYLGSVQALFARVLTLPLVTVAALQGHAFAGG
FT                   AMLSLAHDFQVMRADRGFWCLPEVDLRLPFSVGMSSLISARLPARTAAEAMVTGRRYGG
FT                   ADALAAGIVDAIAAAGVTDASEAERAVETTAIEIARPLTGKASPALGVIKSRLYAATVA
FT                   ALHAMEPVSL"
     MPKLEHDGEV YVLDLGDGEN RFTKDWLVEV EALLSEIEAT DGPKALVTVA RGKIWSNGLD        60
     LDWMIAHTDE LTDYLGSVQA LFARVLTLPL VTVAALQGHA FAGGAMLSLA HDFQVMRADR       120
     GFWCLPEVDL RLPFSVGMSS LISARLPART AAEAMVTGRR YGGADALAAG IVDAIAAAGV       180
     TDASEAERAV ETTAIEIARP LTGKASPALG VIKSRLYAAT VAALHAMEPV SL               232
//

If you have problems or comments...

PBIL Back to PBIL home page