(data stored in ACNUC7421 zone)

EMBL: CP002299.PE506

CP002299.PE506       Location/Qualifiers
FT   CDS             629914..630747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0512"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccs:CCNA_00711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78594"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB64"
FT                   /inference="similar to AA sequence:KEGG:CCNA_00711"
FT                   /protein_id="ADP78594.1"
FT                   /translation="MLRQKVVEKPVVIEIERPVLRRKIVDRPFDVEIEKPVIRQKVVER
FT                   PVVIEIEKPVITEKVVERRVVVEKIVEKPVFKEKIVEKPVVVEKVVEKPVVREKVVEKP
FT                   AGGPGVRPSSGVGADPVRKEPPPVPKAPLTGGAPAHLAPRPTPPPPAGPKPAAPKPAPP
FT                   RPSGLVRPPGAPPAPLAPELAATGRPPAAGSGPRSGPDPNAPRPAQASQPAGGVSFVAP
FT                   TGGGPPDRGGPASGRLDNSTPIADLRSAARELSVNGWARLPKDELVEAIRKVNRR"
     MLRQKVVEKP VVIEIERPVL RRKIVDRPFD VEIEKPVIRQ KVVERPVVIE IEKPVITEKV        60
     VERRVVVEKI VEKPVFKEKI VEKPVVVEKV VEKPVVREKV VEKPAGGPGV RPSSGVGADP       120
     VRKEPPPVPK APLTGGAPAH LAPRPTPPPP AGPKPAAPKP APPRPSGLVR PPGAPPAPLA       180
     PELAATGRPP AAGSGPRSGP DPNAPRPAQA SQPAGGVSFV APTGGGPPDR GGPASGRLDN       240
     STPIADLRSA ARELSVNGWA RLPKDELVEA IRKVNRR                                277
//

If you have problems or comments...

PBIL Back to PBIL home page