(data stored in ACNUC7421 zone)

EMBL: CP002299.PE512

CP002299.PE512       Location/Qualifiers
FT   CDS             complement(641083..647166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0518"
FT                   /product="pentapeptide repeat protein"
FT                   /note="KEGG: sro:Sros_2975 WD40 repeatdomain-containing
FT                   protein-like protein; PFAM: pentapeptide repeat protein;
FT                   WD40 repeat, subgroup; SMART: WD-40 repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78600"
FT                   /db_xref="GOA:E3JB70"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB70"
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /protein_id="ADP78600.1"
FT                   /translation="MWGESAPTAGEVRRIFLSVAGPDERWGSWLDHVLRDAGYEVDFYR
FT                   RSFPLGANFVDQIDAALTRADRMIAVVSPAYLDRSSWVREEWQAGMRLAHTRDGFLLPV
FT                   LVEQCDLPPLLGTINMIVLLGLDRAKAVQTVLRGLVEPATGRPEPEHEPPFPGYEIAGP
FT                   AQRLALPAGAAALPALMAGPPEALGPTMPALGPTTPTPGFTASTPGFTASVPALPEPRA
FT                   DATLAAADRGGERTSITLLHLPALAAPTRPGHAPDTGPEPFGAPLLDDLAVLAASPGLT
FT                   PDLVVVTGVALEGRRGEYEQAAVRLALLADRLGLPVDRIALVPGRGDVSAAAARAYFAA
FT                   CEDEEIEPTAPYWRKWRHFVDFHANLYRELGERTFAVGQEWTLYPMADLRLVVAGLNST
FT                   MAMSHLQADDRGEVGQAQARWFADRLAGYERAGWFRLAVGHHPPLAADRVHSAKATDAY
FT                   GVDLILGGHVNLLLAAHGHGAPTPDGPLPAVPTRLPRSGTTLISAHPPHPVPTADTALR
FT                   YQILRISRAEVTRLDRRFSRRAGAWRPAEEVGAAGTVTYRTRWEHAATTFPRPTRRPPA
FT                   IEGPGSAGKAAARSSNGRKPTGEHRTDDPDSADGPGPRRGETFADRVAEIAELSSPGAT
FT                   ITRISPTGVAPEYLRVTVPHGPVFEQRPVGIAEDGVDESAVDRFVEHVHRQYAATDPQL
FT                   TSDLVYGGPLPAPDELVRQASVRGVRLRSFVEYQGLLDLRGYLRRQSDRLAADRLYPPA
FT                   LYLPQRFRVIDGGPVTADPTDAAPADTTPADTMLDGTLNGMVPTGDGSTDQASGPDGGD
FT                   LLGQLVDWLTADSARFVLILGDFGRGKTFCLHELARTLPERRPHLIPLLIDLRAMEKAH
FT                   SVDELVAAHLVASGEQRVDVSVFRYMLRRGRLVLLFDGFDELALRVTYETAAEHLGRLL
FT                   DAVEGQAKVVVTSRTQHFLSHGQVRGALGARVELLPASRIAEVGDFTERQIEEFLVRLH
FT                   HGDAARARERLELIHDIRDLLGLSHNPRMLGFIASLDTNRLRAVQARTGVISSADLYGE
FT                   LIEEWLRYEERRARPPGAGPALTAGERREAVTALALRLWRTTDQVINLSELTATTSTAL
FT                   DAMTDRVDAGQLDSSQAAHMVGSGSLLVRADDGGFTFIHQSVMEYLVAAAAAQRLADVD
FT                   DLGGGGDVLGARVMSPLMVDFLRGVAGDAAATAWARRALAEPEAGQAPRANALAIARRA
FT                   DPTAARGARLGGAHLEGADLTGLDLSDADLAGANLTDADLDDANLTGANLTGARLTGVR
FT                   ARRLRLTGANLTDADLRRARLTDPDLTGTVLTGSKWERAALLGATPPDRARTAPELAAA
FT                   AVPGRDPVEVVIDSGLRWTQALSPSHDLLAYGTGHHVALEDLADGHVLAVLRGRGEWIR
FT                   AVAFSADGSRLAAGDVAGGIQLWDVAAAEEVASFVGHASRVRALAFSPDGSLLATGCWE
FT                   GRVHVWDLATLTRVATLHKSADRIKTLQFSPDGTLLAYGDEVRLWDVRTRSDLSVLGKP
FT                   TEQARTLRFSPDGTLLAWVNGENTARVWNLAAGREVGRRRGDHHFARALAFDPSGSLVA
FT                   IGADDGTIRVWDLAGDSLRTTLRAARGWVTILEFVGAEGKALIAGTRDGTVQVWKVTDG
FT                   APPGRTLLTGRTADVLATAFVPEQSLVAAASENGSLRLWDTRTAAQVHIGSGEKAWCYA
FT                   MSLTDDATLLAAGGGDGLVRIYELSPGRAGDGRSDLDTPVRRLNTRRTPVRALAFSPDT
FT                   TILAVGHPDGTVGLWNPWTGHPMATLKAGGLRVLTVAFSPDGERLAAGTDTGTVHVWDA
FT                   VGARGGSAAAARRLVGHSDWVNAVAFSPDSELLASGSGSGTVRIWDAATGVLRNRLVGH
FT                   GGRVRTIAFAPDGRLLAAGGEDGIVRLWDPGTGSELARLAGHTEEIRSVAFNAAGDVLV
FT                   SGGADGTARLWQVGDSHRSDGSRELATMLGLAGNRWTALFPDGSYKTSEDRDADSVRTV
FT                   WWSIRLSRFDPDELTPYLPRIRRRPLEAPLATPPS"
     MWGESAPTAG EVRRIFLSVA GPDERWGSWL DHVLRDAGYE VDFYRRSFPL GANFVDQIDA        60
     ALTRADRMIA VVSPAYLDRS SWVREEWQAG MRLAHTRDGF LLPVLVEQCD LPPLLGTINM       120
     IVLLGLDRAK AVQTVLRGLV EPATGRPEPE HEPPFPGYEI AGPAQRLALP AGAAALPALM       180
     AGPPEALGPT MPALGPTTPT PGFTASTPGF TASVPALPEP RADATLAAAD RGGERTSITL       240
     LHLPALAAPT RPGHAPDTGP EPFGAPLLDD LAVLAASPGL TPDLVVVTGV ALEGRRGEYE       300
     QAAVRLALLA DRLGLPVDRI ALVPGRGDVS AAAARAYFAA CEDEEIEPTA PYWRKWRHFV       360
     DFHANLYREL GERTFAVGQE WTLYPMADLR LVVAGLNSTM AMSHLQADDR GEVGQAQARW       420
     FADRLAGYER AGWFRLAVGH HPPLAADRVH SAKATDAYGV DLILGGHVNL LLAAHGHGAP       480
     TPDGPLPAVP TRLPRSGTTL ISAHPPHPVP TADTALRYQI LRISRAEVTR LDRRFSRRAG       540
     AWRPAEEVGA AGTVTYRTRW EHAATTFPRP TRRPPAIEGP GSAGKAAARS SNGRKPTGEH       600
     RTDDPDSADG PGPRRGETFA DRVAEIAELS SPGATITRIS PTGVAPEYLR VTVPHGPVFE       660
     QRPVGIAEDG VDESAVDRFV EHVHRQYAAT DPQLTSDLVY GGPLPAPDEL VRQASVRGVR       720
     LRSFVEYQGL LDLRGYLRRQ SDRLAADRLY PPALYLPQRF RVIDGGPVTA DPTDAAPADT       780
     TPADTMLDGT LNGMVPTGDG STDQASGPDG GDLLGQLVDW LTADSARFVL ILGDFGRGKT       840
     FCLHELARTL PERRPHLIPL LIDLRAMEKA HSVDELVAAH LVASGEQRVD VSVFRYMLRR       900
     GRLVLLFDGF DELALRVTYE TAAEHLGRLL DAVEGQAKVV VTSRTQHFLS HGQVRGALGA       960
     RVELLPASRI AEVGDFTERQ IEEFLVRLHH GDAARARERL ELIHDIRDLL GLSHNPRMLG      1020
     FIASLDTNRL RAVQARTGVI SSADLYGELI EEWLRYEERR ARPPGAGPAL TAGERREAVT      1080
     ALALRLWRTT DQVINLSELT ATTSTALDAM TDRVDAGQLD SSQAAHMVGS GSLLVRADDG      1140
     GFTFIHQSVM EYLVAAAAAQ RLADVDDLGG GGDVLGARVM SPLMVDFLRG VAGDAAATAW      1200
     ARRALAEPEA GQAPRANALA IARRADPTAA RGARLGGAHL EGADLTGLDL SDADLAGANL      1260
     TDADLDDANL TGANLTGARL TGVRARRLRL TGANLTDADL RRARLTDPDL TGTVLTGSKW      1320
     ERAALLGATP PDRARTAPEL AAAAVPGRDP VEVVIDSGLR WTQALSPSHD LLAYGTGHHV      1380
     ALEDLADGHV LAVLRGRGEW IRAVAFSADG SRLAAGDVAG GIQLWDVAAA EEVASFVGHA      1440
     SRVRALAFSP DGSLLATGCW EGRVHVWDLA TLTRVATLHK SADRIKTLQF SPDGTLLAYG      1500
     DEVRLWDVRT RSDLSVLGKP TEQARTLRFS PDGTLLAWVN GENTARVWNL AAGREVGRRR      1560
     GDHHFARALA FDPSGSLVAI GADDGTIRVW DLAGDSLRTT LRAARGWVTI LEFVGAEGKA      1620
     LIAGTRDGTV QVWKVTDGAP PGRTLLTGRT ADVLATAFVP EQSLVAAASE NGSLRLWDTR      1680
     TAAQVHIGSG EKAWCYAMSL TDDATLLAAG GGDGLVRIYE LSPGRAGDGR SDLDTPVRRL      1740
     NTRRTPVRAL AFSPDTTILA VGHPDGTVGL WNPWTGHPMA TLKAGGLRVL TVAFSPDGER      1800
     LAAGTDTGTV HVWDAVGARG GSAAAARRLV GHSDWVNAVA FSPDSELLAS GSGSGTVRIW      1860
     DAATGVLRNR LVGHGGRVRT IAFAPDGRLL AAGGEDGIVR LWDPGTGSEL ARLAGHTEEI      1920
     RSVAFNAAGD VLVSGGADGT ARLWQVGDSH RSDGSRELAT MLGLAGNRWT ALFPDGSYKT      1980
     SEDRDADSVR TVWWSIRLSR FDPDELTPYL PRIRRRPLEA PLATPPS                    2027
//

If you have problems or comments...

PBIL Back to PBIL home page