(data stored in ACNUC7421 zone)

EMBL: CP002299.PE516

CP002299.PE516       Location/Qualifiers
FT   CDS             complement(652078..654411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0522"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: fal:FRAAL6427 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78604"
FT                   /db_xref="GOA:E3JB74"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB74"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6427"
FT                   /protein_id="ADP78604.1"
FT                   /translation="MFARLARGVTGRPRIVLTVALLFVLGAAVLGVGAFGKLLSNGFDD
FT                   PKSDSTRAANEVDTRFGGTPNLVLLVTARSGSVDDPAVAAAGRSLAAELGKEPGVRGVV
FT                   SYWTGAGAALRSTNGREALVVASVDDDHAKAVATKIEKAADDGPVTVRPGGRAGVNRDV
FT                   NAQVTKDLSTAESIAIPITLVLLVVAFAGVVAAALPLGVGLIGILGGFAALSVIGSLTD
FT                   VSIFAVNLATAMGLGLGIDYALLMVSRYREELAAVRRGSAEPLTGIQKRAAVIATVRTA
FT                   GRTILFSGATVIVALAVMLVFPPYFLKSMAYAGIAVTLVTMLTAVLVLPAVLLLLGERV
FT                   NALPVRGLIGLVRRQRTAERGAASDVPREATESPFWRGVATRVMRRPLLAGLPVVALLL
FT                   LLAAPVLHVSFATPDDRVLNAAPSRQVGDVLRADFGSNVSGAMNIVVNGPTSEATLTSY
FT                   AAALSRLPGVGRVDSAAGAFQHGARTSPPGPADARFAADGATYLQVVPSIDPMSASGER
FT                   MAHAARALPAPPGTQVLVGGVSAGLVDGKHAIGSRLPLAIGLIALATFVLLFLFTGSVV
FT                   LPLKALVLNGLVLGAVLGVSVWIFQDGHLSGLFGFTPGPLDTSMPVLLFCIAFGLSMDY
FT                   EVFLLSRIKEEHDAGTPNAEAVAAGLARTGRIVTTAALLLAVTFAAFATGSVRFMQMFG
FT                   LATALAIVLDASLVRGVLVPAFMRVAGDVNWWAPAPLRRLHNRIGLSEGGPAAGPTAPE
FT                   TVAVPRPSAEPDLGLTEKSSSTAS"
     MFARLARGVT GRPRIVLTVA LLFVLGAAVL GVGAFGKLLS NGFDDPKSDS TRAANEVDTR        60
     FGGTPNLVLL VTARSGSVDD PAVAAAGRSL AAELGKEPGV RGVVSYWTGA GAALRSTNGR       120
     EALVVASVDD DHAKAVATKI EKAADDGPVT VRPGGRAGVN RDVNAQVTKD LSTAESIAIP       180
     ITLVLLVVAF AGVVAAALPL GVGLIGILGG FAALSVIGSL TDVSIFAVNL ATAMGLGLGI       240
     DYALLMVSRY REELAAVRRG SAEPLTGIQK RAAVIATVRT AGRTILFSGA TVIVALAVML       300
     VFPPYFLKSM AYAGIAVTLV TMLTAVLVLP AVLLLLGERV NALPVRGLIG LVRRQRTAER       360
     GAASDVPREA TESPFWRGVA TRVMRRPLLA GLPVVALLLL LAAPVLHVSF ATPDDRVLNA       420
     APSRQVGDVL RADFGSNVSG AMNIVVNGPT SEATLTSYAA ALSRLPGVGR VDSAAGAFQH       480
     GARTSPPGPA DARFAADGAT YLQVVPSIDP MSASGERMAH AARALPAPPG TQVLVGGVSA       540
     GLVDGKHAIG SRLPLAIGLI ALATFVLLFL FTGSVVLPLK ALVLNGLVLG AVLGVSVWIF       600
     QDGHLSGLFG FTPGPLDTSM PVLLFCIAFG LSMDYEVFLL SRIKEEHDAG TPNAEAVAAG       660
     LARTGRIVTT AALLLAVTFA AFATGSVRFM QMFGLATALA IVLDASLVRG VLVPAFMRVA       720
     GDVNWWAPAP LRRLHNRIGL SEGGPAAGPT APETVAVPRP SAEPDLGLTE KSSSTAS          777
//

If you have problems or comments...

PBIL Back to PBIL home page