(data stored in ACNUC7421 zone)

EMBL: CP002299.PE517

CP002299.PE517       Location/Qualifiers
FT   CDS             654529..655305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0523"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: fal:FRAAL6428
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78605"
FT                   /db_xref="GOA:E3JB75"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB75"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADP78605.1"
FT                   /translation="MNPLAPRRERLRAATIAEIKQAARDQAATGGVGAISLRGVAKAMG
FT                   MAPSALYRYFDSHDVLVTELCADAFASLADALEAAYVVERDIDHARRWLSLARAYRRWA
FT                   HEHETEYILLFGPRSTLDLDDKSGRCGAEMRRAVGVLFQCMITEIAAGVIDPSHLDAGL
FT                   KPELRERLAAWGVEEGAPISSAALAGCLIVWTQLHGFLSLELFGHLPPILGDVSDLYDQ
FT                   QMLDVIVRIGYREPIDLAAVTAPGPDPVTVATGSGV"
     MNPLAPRRER LRAATIAEIK QAARDQAATG GVGAISLRGV AKAMGMAPSA LYRYFDSHDV        60
     LVTELCADAF ASLADALEAA YVVERDIDHA RRWLSLARAY RRWAHEHETE YILLFGPRST       120
     LDLDDKSGRC GAEMRRAVGV LFQCMITEIA AGVIDPSHLD AGLKPELRER LAAWGVEEGA       180
     PISSAALAGC LIVWTQLHGF LSLELFGHLP PILGDVSDLY DQQMLDVIVR IGYREPIDLA       240
     AVTAPGPDPV TVATGSGV                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page