(data stored in ACNUC7421 zone)

EMBL: CP002299.PE519

CP002299.PE519       Location/Qualifiers
FT   CDS             complement(657137..657646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0525"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="KEGG: fal:FRAAL6416 hypothetical protein; PFAM:
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78607"
FT                   /db_xref="GOA:E3JB77"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB77"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADP78607.1"
FT                   /translation="MTPVPRAESKGELVSVDVVRRAGSTTPQATHILAELPYLPSAVPR
FT                   ARHVLRESLRSAGLDEDATAVAELLVSELVTNAVKYGQPPVWLLVELRPGLVHASVSDT
FT                   STSLPERRAVDDDSEGGRGLLVLDALAGSWGAVTADHGKYLWFDLVVTPAPATEPDPGK
FT                   PGVSAA"
     MTPVPRAESK GELVSVDVVR RAGSTTPQAT HILAELPYLP SAVPRARHVL RESLRSAGLD        60
     EDATAVAELL VSELVTNAVK YGQPPVWLLV ELRPGLVHAS VSDTSTSLPE RRAVDDDSEG       120
     GRGLLVLDAL AGSWGAVTAD HGKYLWFDLV VTPAPATEPD PGKPGVSAA                   169
//

If you have problems or comments...

PBIL Back to PBIL home page