(data stored in ACNUC7421 zone)

EMBL: CP002299.PE520

CP002299.PE520       Location/Qualifiers
FT   CDS             complement(658123..660564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0526"
FT                   /product="protein serine phosphatase with GAF(s) sensor(s)"
FT                   /note="KEGG: fal:FRAAL6415 putative regulatory protein;
FT                   PFAM: Stage II sporulation protein E; ATP-binding region
FT                   ATPase domain protein; SMART: protein phosphatase 2C domain
FT                   protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78608"
FT                   /db_xref="GOA:E3JB78"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB78"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADP78608.1"
FT                   /translation="MDGAGLDGRPPHHTITLPPAAESPRSARRFLLSALRGTVDEDTLD
FT                   SALLLVTELVTNVVVHAGTPATVDVTAEPVGELTIQVRDLHPVRIGAARHRPGNGGSDS
FT                   ANDPFSESGLGGLREDGRGLALVDALASSWGTAHGAGGKSVWFRLTAAAQPAPDEPGEP
FT                   LTGSGNVPQDGPSGPDTDVTLDTSTPTSTATVAASTPRQAGSGERTGAEAARAGAVPAA
FT                   NPIAGPTLPTAVPTDPPPPAAFPPGHGTNGSGPATTHTATTGAEGGGPGRRAPVLLDKA
FT                   PAGPVPRVPRIVSRSTARALTAEGEVAELLAQLVDTQPVTGGLVHRPSQDDPRPEVVAS
FT                   LGGLGDAGAAVAIPLDPTQDTLGEVLLWPDPTQPGYLGQPGAVDLERVELVARWMALAL
FT                   GGGDMRQAEERRIGMLSFLAEASDLLAGSLELEHTLSMLAHLPVPRLGRWCAVYLRRDD
FT                   GNPTLAAVAHAEEAAEPALSDTATDLTGPLMIAVRGAGTTPVRQVSTPDGPVLVAVLRA
FT                   RRRVLGMVAVGRDVGGSFTADDADLLADLARRAAFAVDNARLYSRQVELADGLQAGLRP
FT                   PVLPEIPGLDLGAAYGAAQSAGLDVGGDFFDLMPGPNGWTVAIGDVCGKGAEAATVTGV
FT                   ARAVLRLLTGQATPVGQILGDLNRTLRDTATAYPHGQPRFCTLATASLAEPTQRGVHLV
FT                   LHLAGHPQPVLLRADGTASYVGVPGTLLGVLDDDEVTFPSVDVELCSGDALVLYTDGVV
FT                   EARAGRELLGEQRLLEAVVDCAGLSAQGIADRVRAAADRFAGGNLRDDVAIVVLRTPAS
FT                   G"
     MDGAGLDGRP PHHTITLPPA AESPRSARRF LLSALRGTVD EDTLDSALLL VTELVTNVVV        60
     HAGTPATVDV TAEPVGELTI QVRDLHPVRI GAARHRPGNG GSDSANDPFS ESGLGGLRED       120
     GRGLALVDAL ASSWGTAHGA GGKSVWFRLT AAAQPAPDEP GEPLTGSGNV PQDGPSGPDT       180
     DVTLDTSTPT STATVAASTP RQAGSGERTG AEAARAGAVP AANPIAGPTL PTAVPTDPPP       240
     PAAFPPGHGT NGSGPATTHT ATTGAEGGGP GRRAPVLLDK APAGPVPRVP RIVSRSTARA       300
     LTAEGEVAEL LAQLVDTQPV TGGLVHRPSQ DDPRPEVVAS LGGLGDAGAA VAIPLDPTQD       360
     TLGEVLLWPD PTQPGYLGQP GAVDLERVEL VARWMALALG GGDMRQAEER RIGMLSFLAE       420
     ASDLLAGSLE LEHTLSMLAH LPVPRLGRWC AVYLRRDDGN PTLAAVAHAE EAAEPALSDT       480
     ATDLTGPLMI AVRGAGTTPV RQVSTPDGPV LVAVLRARRR VLGMVAVGRD VGGSFTADDA       540
     DLLADLARRA AFAVDNARLY SRQVELADGL QAGLRPPVLP EIPGLDLGAA YGAAQSAGLD       600
     VGGDFFDLMP GPNGWTVAIG DVCGKGAEAA TVTGVARAVL RLLTGQATPV GQILGDLNRT       660
     LRDTATAYPH GQPRFCTLAT ASLAEPTQRG VHLVLHLAGH PQPVLLRADG TASYVGVPGT       720
     LLGVLDDDEV TFPSVDVELC SGDALVLYTD GVVEARAGRE LLGEQRLLEA VVDCAGLSAQ       780
     GIADRVRAAA DRFAGGNLRD DVAIVVLRTP ASG                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page