(data stored in ACNUC7421 zone)

EMBL: CP002299.PE522

CP002299.PE522       Location/Qualifiers
FT   CDS             665195..665836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0528"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: fal:FRAAL6413 two-component regulator; PFAM:
FT                   response regulator receiver; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78610"
FT                   /db_xref="GOA:E3JB80"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB80"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADP78610.1"
FT                   /translation="MTERTGGPVDPGGGPSTERPRSKILLVDDRPDNLMALEAILASLD
FT                   QELVTASSGEEALKRLLVDDFAVILLDVQMPGMDGFETAHRIKQRGRTRDTPIIFLTAI
FT                   DREPHHAFRGYAVGAVDYIAKPFDPWLLRAKVSVFVELFEKNERLGELVHQRGQDFDLM
FT                   TEVAERLIALDVLLEGARDASPEEIIAAAGAEVRGLVARMSPFARSTPTT"
     MTERTGGPVD PGGGPSTERP RSKILLVDDR PDNLMALEAI LASLDQELVT ASSGEEALKR        60
     LLVDDFAVIL LDVQMPGMDG FETAHRIKQR GRTRDTPIIF LTAIDREPHH AFRGYAVGAV       120
     DYIAKPFDPW LLRAKVSVFV ELFEKNERLG ELVHQRGQDF DLMTEVAERL IALDVLLEGA       180
     RDASPEEIIA AAGAEVRGLV ARMSPFARST PTT                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page