(data stored in ACNUC7421 zone)

EMBL: CP002299.PE523

CP002299.PE523       Location/Qualifiers
FT   CDS             complement(665994..666425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0529"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   fal:FRAAL6408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78611"
FT                   /db_xref="GOA:E3JB81"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB81"
FT                   /inference="protein motif:PFAM:PF02583"
FT                   /protein_id="ADP78611.1"
FT                   /translation="MSTSPRTGGEVDPTAGRNPPTGQNPVASTEPGPGADPAAGATSAV
FT                   AEPAPPHGYSHHREDYLARLRRVEGQVRGLQRMVSDDKYCIDILTQVAAVTRALQSVAL
FT                   GLLEDHLGHCVADAAAEGGPVAEAKLREASAAIARLVRS"
     MSTSPRTGGE VDPTAGRNPP TGQNPVASTE PGPGADPAAG ATSAVAEPAP PHGYSHHRED        60
     YLARLRRVEG QVRGLQRMVS DDKYCIDILT QVAAVTRALQ SVALGLLEDH LGHCVADAAA       120
     EGGPVAEAKL REASAAIARL VRS                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page