(data stored in ACNUC7421 zone)

EMBL: CP002299.PE524

CP002299.PE524       Location/Qualifiers
FT   CDS             complement(666549..667298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0530"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: fal:FRAAL6406
FT                   isochorismatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78612"
FT                   /db_xref="GOA:E3JB82"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB82"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADP78612.1"
FT                   /translation="MTDTETATATSGATNGPAVFGTVDAEPYAWPYNGTFTAATTAVIN
FT                   IDWQVDFCGKGGYVDAMGYDLELTRAGLAPTARLLEALRPLGFFIIHTREGHRPDLSDC
FT                   PPNKLWRSKNIGAGIGDEGPQGRILTRGEPGWEIVDEVAPLPGEVVIDKPGKGSFYATD
FT                   LNLVLNRAGITHIILTGITTDVCVHTTMRDANDRGYECLLLSDCTGATDYGNYLAALNM
FT                   VKMQGGVFGAVATSDALLASVGAPVNA"
     MTDTETATAT SGATNGPAVF GTVDAEPYAW PYNGTFTAAT TAVINIDWQV DFCGKGGYVD        60
     AMGYDLELTR AGLAPTARLL EALRPLGFFI IHTREGHRPD LSDCPPNKLW RSKNIGAGIG       120
     DEGPQGRILT RGEPGWEIVD EVAPLPGEVV IDKPGKGSFY ATDLNLVLNR AGITHIILTG       180
     ITTDVCVHTT MRDANDRGYE CLLLSDCTGA TDYGNYLAAL NMVKMQGGVF GAVATSDALL       240
     ASVGAPVNA                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page