(data stored in ACNUC7421 zone)

EMBL: CP002299.PE529

CP002299.PE529       Location/Qualifiers
FT   CDS             complement(672917..673726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0535"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: fal:FRAAL6405 putative transcriptional
FT                   regulatory protein; PFAM: GntR domain protein; regulatory
FT                   protein GntR HTH; SMART: GntR domain protein; regulatory
FT                   protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78617"
FT                   /db_xref="GOA:E3JB87"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB87"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADP78617.1"
FT                   /translation="MTPTQPPTARPSSAQPTAGRPSTAQAPTERFTPRPPSARNATTGN
FT                   LREHAYVGLRQRLMAGEFSFRDRLTEERLAALLGVSRTPVREALTRLAGDGLVEKRLDG
FT                   GYYPAEPDLDGLRDLYEIRVVLELHSLERALESGVPHDPALLEPLRENWEALRQAPPDP
FT                   DPSFVALDEGFHLTLCRASGNVELANMLDAINARIRPVRMHDFLTEDRIHMTIEQHLDI
FT                   VETVLGGDLPEAVRKLRNHVGESMEVVEKRAASAITQMALRRGRSPR"
     MTPTQPPTAR PSSAQPTAGR PSTAQAPTER FTPRPPSARN ATTGNLREHA YVGLRQRLMA        60
     GEFSFRDRLT EERLAALLGV SRTPVREALT RLAGDGLVEK RLDGGYYPAE PDLDGLRDLY       120
     EIRVVLELHS LERALESGVP HDPALLEPLR ENWEALRQAP PDPDPSFVAL DEGFHLTLCR       180
     ASGNVELANM LDAINARIRP VRMHDFLTED RIHMTIEQHL DIVETVLGGD LPEAVRKLRN       240
     HVGESMEVVE KRAASAITQM ALRRGRSPR                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page