(data stored in ACNUC7421 zone)

EMBL: CP002299.PE53

CP002299.PE53        Location/Qualifiers
FT   CDS             59567..60472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0053"
FT                   /product="protein phosphatase 2C domain protein"
FT                   /note="SMART: protein phosphatase 2C domain protein; KEGG:
FT                   rci:RRC32 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78141"
FT                   /db_xref="GOA:E3J3D9"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3D9"
FT                   /inference="protein motif:SMART:SM00331"
FT                   /protein_id="ADP78141.1"
FT                   /translation="MTARSTARRPADSAPKGPAVRVAGDAVRTALLLGPDHPGLGEVAL
FT                   GGLSVEGDGAPTMLGAALSAGWRPKAVPAVEPNEDGALLAVGPAGALLAVADGHNGSAA
FT                   STAALRALAARAPVLLAHRTGDEAELAAAFAAAAHGAVARPPAPGGSEAGAEGEPRPAR
FT                   TALSLVVVTAAAFAAVGYGDTTAAVVRRGRLHLLDEPSEFLGPTSPADPLAGHPVTRRR
FT                   RGPGDLLVVVSDGVTDYLGRAFGAAIEAASRAGADGGQPDAARATARSLIARAGAAGAG
FT                   DNLTAAVLLAARPRRTFGWF"
     MTARSTARRP ADSAPKGPAV RVAGDAVRTA LLLGPDHPGL GEVALGGLSV EGDGAPTMLG        60
     AALSAGWRPK AVPAVEPNED GALLAVGPAG ALLAVADGHN GSAASTAALR ALAARAPVLL       120
     AHRTGDEAEL AAAFAAAAHG AVARPPAPGG SEAGAEGEPR PARTALSLVV VTAAAFAAVG       180
     YGDTTAAVVR RGRLHLLDEP SEFLGPTSPA DPLAGHPVTR RRRGPGDLLV VVSDGVTDYL       240
     GRAFGAAIEA ASRAGADGGQ PDAARATARS LIARAGAAGA GDNLTAAVLL AARPRRTFGW       300
     F                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page