(data stored in ACNUC7421 zone)

EMBL: CP002299.PE530

CP002299.PE530       Location/Qualifiers
FT   CDS             674175..674939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0536"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6404 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78618"
FT                   /db_xref="GOA:E3JB88"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB88"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6404"
FT                   /protein_id="ADP78618.1"
FT                   /translation="MGTITARTTPAPSFLLLHGAATTGAIWAGVRRALGDRPAFAPDRP
FT                   SSGDLDSELAAVREAVALAAAATPAAARSVDAPAPPRLAAGAAVTTTREGPRAVVFGGV
FT                   SGGATLGLAALATGVPLAAAVLHEPAVGSLLPGLLAPMAAAYASGGVAAFASALYGPSW
FT                   RPTDGPADPDAVARDLSMFLRFEPAAPGPTPGPVVVTVGERSPEIRHRAAAALHRELGL
FT                   EVRVLAGCGHAAHLEAPAQFADLLAEIAATLG"
     MGTITARTTP APSFLLLHGA ATTGAIWAGV RRALGDRPAF APDRPSSGDL DSELAAVREA        60
     VALAAAATPA AARSVDAPAP PRLAAGAAVT TTREGPRAVV FGGVSGGATL GLAALATGVP       120
     LAAAVLHEPA VGSLLPGLLA PMAAAYASGG VAAFASALYG PSWRPTDGPA DPDAVARDLS       180
     MFLRFEPAAP GPTPGPVVVT VGERSPEIRH RAAAALHREL GLEVRVLAGC GHAAHLEAPA       240
     QFADLLAEIA ATLG                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page