(data stored in ACNUC7421 zone)

EMBL: CP002299.PE533

CP002299.PE533       Location/Qualifiers
FT   CDS             complement(676055..676405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0539"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="KEGG: scb:SCAB_53081 hypothetical protein; TIGRFAM:
FT                   regulatory protein, FmdB family; PFAM: Putative regulatory
FT                   protein FmdB"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78621"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB91"
FT                   /inference="protein motif:TFAM:TIGR02605"
FT                   /protein_id="ADP78621.1"
FT                   /translation="MPTYQYRCTACGNDLEAVQSFSDAALTECPVCGGQLRKVFSSVGL
FT                   VFKGSGFYKTDSRSGSSATAPAQRKDGTADTGSKEAPKTDAASSPSTTSPAPAAAPATS
FT                   GSTSATSSASAA"
     MPTYQYRCTA CGNDLEAVQS FSDAALTECP VCGGQLRKVF SSVGLVFKGS GFYKTDSRSG        60
     SSATAPAQRK DGTADTGSKE APKTDAASSP STTSPAPAAA PATSGSTSAT SSASAA           116
//

If you have problems or comments...

PBIL Back to PBIL home page