(data stored in ACNUC7421 zone)

EMBL: CP002299.PE534

CP002299.PE534       Location/Qualifiers
FT   CDS             complement(676710..677405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0540"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="KEGG: fal:FRAAL6398 putative ligase (partial match);
FT                   TIGRFAM: 5-formyltetrahydrofolate cyclo-ligase; PFAM:
FT                   5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78622"
FT                   /db_xref="GOA:E3JB92"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB92"
FT                   /inference="protein motif:TFAM:TIGR02727"
FT                   /protein_id="ADP78622.1"
FT                   /translation="MGEQDADDAIARAKSDLRRALAACRRGVGPRPGPGPVIGLPGSWA
FT                   ASDREPAGPSPSIQTGAQPRAQEAADGAQIARRVLSLPEVTAADRIAAFVSLPGEPSTL
FT                   PLLDTLRARGVHVLLPAVRGDLDLDFREYTGTLVPGALGTREPPRAAATVDLASADVVL
FT                   VPAVAVDPRGHRLGRGGGSYDRALRRVRDAATLVALVDEHAIVEAVPVAAHDRSVSVIV
FT                   TPTRLLRCR"
     MGEQDADDAI ARAKSDLRRA LAACRRGVGP RPGPGPVIGL PGSWAASDRE PAGPSPSIQT        60
     GAQPRAQEAA DGAQIARRVL SLPEVTAADR IAAFVSLPGE PSTLPLLDTL RARGVHVLLP       120
     AVRGDLDLDF REYTGTLVPG ALGTREPPRA AATVDLASAD VVLVPAVAVD PRGHRLGRGG       180
     GSYDRALRRV RDAATLVALV DEHAIVEAVP VAAHDRSVSV IVTPTRLLRC R                231
//

If you have problems or comments...

PBIL Back to PBIL home page