(data stored in ACNUC7421 zone)

EMBL: CP002299.PE535

CP002299.PE535       Location/Qualifiers
FT   CDS             677668..678588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0541"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /note="KEGG: fal:FRAAL6397 UTP--glucose-1-phosphate
FT                   uridylyltransferase; TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78623"
FT                   /db_xref="GOA:E3JB93"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB93"
FT                   /inference="protein motif:TFAM:TIGR01099"
FT                   /protein_id="ADP78623.1"
FT                   /translation="MPVTKAVIPAAGLGTRFLPATKAVPKEMLPVVDRPAIEYVVEEAA
FT                   RAGLRDVLLVTSRSKKAVEDHFDRDAELELALERKGDGARLARVRGSAELAEVHSVRQG
FT                   APRGLGHAVLCGAPHVGDEPFAVLLGDDLIDERDPLLEEMLAVQERFGGSVIALMEVPE
FT                   EVVSLYGVATVDPAPVAAGGRYETVRIRDLVEKPPADEAPSNLAIIGRYVLAPKVFEVL
FT                   RRTPPGRGGEIQLTDALRELAQAADEVGEPVHGVVFTGRRYDTGDRVDYLKAVIRLACE
FT                   RADLGPEIYPWLEEYVANGGPKADN"
     MPVTKAVIPA AGLGTRFLPA TKAVPKEMLP VVDRPAIEYV VEEAARAGLR DVLLVTSRSK        60
     KAVEDHFDRD AELELALERK GDGARLARVR GSAELAEVHS VRQGAPRGLG HAVLCGAPHV       120
     GDEPFAVLLG DDLIDERDPL LEEMLAVQER FGGSVIALME VPEEVVSLYG VATVDPAPVA       180
     AGGRYETVRI RDLVEKPPAD EAPSNLAIIG RYVLAPKVFE VLRRTPPGRG GEIQLTDALR       240
     ELAQAADEVG EPVHGVVFTG RRYDTGDRVD YLKAVIRLAC ERADLGPEIY PWLEEYVANG       300
     GPKADN                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page