(data stored in ACNUC7421 zone)

EMBL: CP002299.PE538

CP002299.PE538       Location/Qualifiers
FT   CDS             680764..681315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0544"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="KEGG: fal:FRAAL6394 molybdenum cofactor biosynthesis
FT                   protein; TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78626"
FT                   /db_xref="GOA:E3JB96"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB96"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ADP78626.1"
FT                   /translation="MTGPAQVPTGARASVVTVSDRASAGTYADRSGPLLAAGLVELGFA
FT                   VDGPVVVPDERGRIVAALRAALSAGADLVVTTGGTGLAPRDVTPEATAEVVERDVPGLA
FT                   EALRAAGRDKVPTAMLSRGRAGVVGRALVVNLPGSTGGVRDGLGVLGAVVGHALDQLRG
FT                   GDHRPSDGPGPQSRRPDPSQ"
     MTGPAQVPTG ARASVVTVSD RASAGTYADR SGPLLAAGLV ELGFAVDGPV VVPDERGRIV        60
     AALRAALSAG ADLVVTTGGT GLAPRDVTPE ATAEVVERDV PGLAEALRAA GRDKVPTAML       120
     SRGRAGVVGR ALVVNLPGST GGVRDGLGVL GAVVGHALDQ LRGGDHRPSD GPGPQSRRPD       180
     PSQ                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page