(data stored in ACNUC7421 zone)

EMBL: CP002299.PE540

CP002299.PE540       Location/Qualifiers
FT   CDS             682498..683856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0546"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6391 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78628"
FT                   /db_xref="GOA:E3JB98"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB98"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6391"
FT                   /protein_id="ADP78628.1"
FT                   /translation="MSALIWLAIVGVWGFVLIPMWLRRHDGALEQRSADRFSTAMRVLS
FT                   RRGGRAQPERHPETDLGDGLADEDDEADDADDLESTMELQTRPAAADDAPDGRQATASR
FT                   PAGDPSGPTAGRVTAGPAVPTRADVPVPSRGAVPARPATRSQAVARDARGEQDETAHTV
FT                   PVGAARPVPPSRPVDPERHALLRLRRQRLYVLLAAVPVTVGLAIGLAGMWIVVQALVDV
FT                   GLGAYVAHLRRSARTERRLAASRAARDRRIAADRAARRSNWAGPAHGTAGVPGARTAAS
FT                   PARATPPAAVRQGRPADPATAGPAGRPHVSAGGRAAASPEYAPVRLSDDHAAPLSSEEL
FT                   ATARAETVEIATPSPALPVAPEPAAVDDGYTNNVRVTAARPTGRPTVRPPTSRPGRVQV
FT                   NPPGTHGGLTAPPQPAAAAPAATPPAEPGTAQDGTPTDAEVAAVRLLRPAVGN"
     MSALIWLAIV GVWGFVLIPM WLRRHDGALE QRSADRFSTA MRVLSRRGGR AQPERHPETD        60
     LGDGLADEDD EADDADDLES TMELQTRPAA ADDAPDGRQA TASRPAGDPS GPTAGRVTAG       120
     PAVPTRADVP VPSRGAVPAR PATRSQAVAR DARGEQDETA HTVPVGAARP VPPSRPVDPE       180
     RHALLRLRRQ RLYVLLAAVP VTVGLAIGLA GMWIVVQALV DVGLGAYVAH LRRSARTERR       240
     LAASRAARDR RIAADRAARR SNWAGPAHGT AGVPGARTAA SPARATPPAA VRQGRPADPA       300
     TAGPAGRPHV SAGGRAAASP EYAPVRLSDD HAAPLSSEEL ATARAETVEI ATPSPALPVA       360
     PEPAAVDDGY TNNVRVTAAR PTGRPTVRPP TSRPGRVQVN PPGTHGGLTA PPQPAAAAPA       420
     ATPPAEPGTA QDGTPTDAEV AAVRLLRPAV GN                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page