(data stored in ACNUC7421 zone)

EMBL: CP002299.PE541

CP002299.PE541       Location/Qualifiers
FT   CDS             684793..685407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0547"
FT                   /product="Protein of unknown function DUF2493"
FT                   /note="PFAM: Protein of unknown function DUF2493; KEGG:
FT                   fal:FRAAL6316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78629"
FT                   /db_xref="UniProtKB/TrEMBL:E3JB99"
FT                   /inference="protein motif:PFAM:PF10686"
FT                   /protein_id="ADP78629.1"
FT                   /translation="MTFEAWLGRLRNDGYLLCPASTAVPVELRAVRPDGWGLHLRCRGV
FT                   HVRLGLYRPGRPAWQVPLRDRHVIPEEALELWEHRPLRQAADPGAGLPAGTRIVFTGAE
FT                   DLPDHQLVFDGSREHGWRGHEAGLLRAPAAAEIFATLLAAAEPELDRWRPSVATAGGLR
FT                   LSPASLSAAEAAPRKGAAVPSARVAASARPTVAAGADQARS"
     MTFEAWLGRL RNDGYLLCPA STAVPVELRA VRPDGWGLHL RCRGVHVRLG LYRPGRPAWQ        60
     VPLRDRHVIP EEALELWEHR PLRQAADPGA GLPAGTRIVF TGAEDLPDHQ LVFDGSREHG       120
     WRGHEAGLLR APAAAEIFAT LLAAAEPELD RWRPSVATAG GLRLSPASLS AAEAAPRKGA       180
     AVPSARVAAS ARPTVAAGAD QARS                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page