(data stored in ACNUC7421 zone)

EMBL: CP002299.PE547

CP002299.PE547       Location/Qualifiers
FT   CDS             complement(695076..697613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0555"
FT                   /product="PKD domain containing protein"
FT                   /note="KEGG: nml:Namu_4457 PKD domain containing protein;
FT                   PFAM: PKD domain containing protein; SMART: PKD domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78635"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBA5"
FT                   /inference="protein motif:PFAM:PF00801"
FT                   /protein_id="ADP78635.1"
FT                   /translation="MSGTSGLGASRVRHAAGPALRWAPRLLLAVLVLAGACAVIAGNGA
FT                   GAAARSVSLEDSAAWLLSPTIGETELVDGNTGAVITRVTLGAGQLAGAQSGADEVVADT
FT                   GGGTVRRVDGATYRVSAAVRPGRPGEPLTVYPTKSTLFIANRTTGLVTAADPERLTTRY
FT                   TASLSARMPVGGVAADGNTGLWAIDATTGDLAHVGPSGTTIRRHAVDPAHTQLVTAAGR
FT                   AVAVDLTAGRAVTITASGGGGPAACVDTAVGDTTVSVVPATSAEQVYVTSGQRGVLLIS
FT                   DLATGRCGRAIDLGVAGHRLGQAVETARRLFVPDYTTGQVIVADLASGRVIASPTVLPP
FT                   GTLFELASQGSITFFNDPSTARAGIISLDGTVRAVQKYDAANPGSSAGGHSGSSGPSGG
FT                   SDPLTAADVSGPTGPVTPGPTPTPTTPVTGRSSVQPSNGPATVGGSLQTAVPLDGRTPA
FT                   AAAPGARIEVSAPRARMADPLTLHAVLVGANGQVSDARITSTAWTFGDGATGGGVRVSH
FT                   AWAAAGTYQVGAAIRLRDGTSTAASTVITITAQAPPITGPSTTPVSPPPSSRPTTPPTT
FT                   PAAKPKAALFAQQSTPSSGQQVPLEVAADATGSSGSGALRYTFDFGDGTAAVGPQAGVT
FT                   ARHDYAATGTYPVRLTVTDATGATDAVEESVLVAPAGAAWVDVRPDSGQGPPLTATADA
FT                   SASSGTGTLHYTFSFGDGSASVGPQTGATVTHTYTAPGQYALSVTVTDAVGGKYVNSSD
FT                   VVVDPVWTVTPSSGPAPLTVEAQVVASQAGATYDWGFGDGTPGTGWQTAPTATHTYTAP
FT                   GTYQVFLEFQYASGAFGTRTMNVTVTGPAAAPG"
     MSGTSGLGAS RVRHAAGPAL RWAPRLLLAV LVLAGACAVI AGNGAGAAAR SVSLEDSAAW        60
     LLSPTIGETE LVDGNTGAVI TRVTLGAGQL AGAQSGADEV VADTGGGTVR RVDGATYRVS       120
     AAVRPGRPGE PLTVYPTKST LFIANRTTGL VTAADPERLT TRYTASLSAR MPVGGVAADG       180
     NTGLWAIDAT TGDLAHVGPS GTTIRRHAVD PAHTQLVTAA GRAVAVDLTA GRAVTITASG       240
     GGGPAACVDT AVGDTTVSVV PATSAEQVYV TSGQRGVLLI SDLATGRCGR AIDLGVAGHR       300
     LGQAVETARR LFVPDYTTGQ VIVADLASGR VIASPTVLPP GTLFELASQG SITFFNDPST       360
     ARAGIISLDG TVRAVQKYDA ANPGSSAGGH SGSSGPSGGS DPLTAADVSG PTGPVTPGPT       420
     PTPTTPVTGR SSVQPSNGPA TVGGSLQTAV PLDGRTPAAA APGARIEVSA PRARMADPLT       480
     LHAVLVGANG QVSDARITST AWTFGDGATG GGVRVSHAWA AAGTYQVGAA IRLRDGTSTA       540
     ASTVITITAQ APPITGPSTT PVSPPPSSRP TTPPTTPAAK PKAALFAQQS TPSSGQQVPL       600
     EVAADATGSS GSGALRYTFD FGDGTAAVGP QAGVTARHDY AATGTYPVRL TVTDATGATD       660
     AVEESVLVAP AGAAWVDVRP DSGQGPPLTA TADASASSGT GTLHYTFSFG DGSASVGPQT       720
     GATVTHTYTA PGQYALSVTV TDAVGGKYVN SSDVVVDPVW TVTPSSGPAP LTVEAQVVAS       780
     QAGATYDWGF GDGTPGTGWQ TAPTATHTYT APGTYQVFLE FQYASGAFGT RTMNVTVTGP       840
     AAAPG                                                                   845
//

If you have problems or comments...

PBIL Back to PBIL home page