(data stored in ACNUC7421 zone)

EMBL: CP002299.PE549

CP002299.PE549       Location/Qualifiers
FT   CDS             699848..700492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0557"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sco:SCO1904
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78637"
FT                   /db_xref="GOA:E3JBA7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBA7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADP78637.1"
FT                   /translation="MATLTARRDDARRNRETILRVADGAFADGSDAVPLDEIARRAGLG
FT                   RATVYRHFPDRHALAVAVAAQNLEALREVVRADGDDRCPFRDILGMVFSTQASMRPLVA
FT                   LMLELPVREQLQYTEALIEALTPPFRQAQADGELRPDAEPADLALVMAMINTAVDAVPV
FT                   GLDHGAALRRIVTTILDGLFGPSTPVDDQDRADGPEEPAAAGSRCRTRRFV"
     MATLTARRDD ARRNRETILR VADGAFADGS DAVPLDEIAR RAGLGRATVY RHFPDRHALA        60
     VAVAAQNLEA LREVVRADGD DRCPFRDILG MVFSTQASMR PLVALMLELP VREQLQYTEA       120
     LIEALTPPFR QAQADGELRP DAEPADLALV MAMINTAVDA VPVGLDHGAA LRRIVTTILD       180
     GLFGPSTPVD DQDRADGPEE PAAAGSRCRT RRFV                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page