(data stored in ACNUC7421 zone)

EMBL: CP002299.PE55

CP002299.PE55        Location/Qualifiers
FT   CDS             61563..62177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0055"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78143"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3E1"
FT                   /inference="similar to AA sequence:KEGG:FRAAL1370"
FT                   /protein_id="ADP78143.1"
FT                   /translation="MVDVGPPSREEPDPTGSEPAGPGIQSAMVALIQDTRGDGSAVVRY
FT                   IQCDNCEGPTPHHAEVQIFSATSRNPTFVASPPEVVCGVCGSVHPRVVGDEPACDTRIT
FT                   CVARRVPRLPLDRLGLDRLRLDRLPLGRLRDRAGLDRLPFGRVLPDAVRQLRWPGACAH
FT                   RFLVPAAAPTVICPRCSSTQAGPPYRLRAPYPDQEPDPRNA"
     MVDVGPPSRE EPDPTGSEPA GPGIQSAMVA LIQDTRGDGS AVVRYIQCDN CEGPTPHHAE        60
     VQIFSATSRN PTFVASPPEV VCGVCGSVHP RVVGDEPACD TRITCVARRV PRLPLDRLGL       120
     DRLRLDRLPL GRLRDRAGLD RLPFGRVLPD AVRQLRWPGA CAHRFLVPAA APTVICPRCS       180
     STQAGPPYRL RAPYPDQEPD PRNA                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page