(data stored in ACNUC7421 zone)

EMBL: CP002299.PE550

CP002299.PE550       Location/Qualifiers
FT   CDS             700902..702182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0559"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sen:SACE_3205 transmembrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78638"
FT                   /db_xref="GOA:E3JBA8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBA8"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADP78638.1"
FT                   /translation="MARRSLGRRFGWLWAAYAVSAYGSGLALGAFPLIAVLVLRAGPAK
FT                   VSALSAVGPAMGALIALPLGPWVEYRRRRPVMISMDLARFAALMTIPVAYAFGRLSFAQ
FT                   LLVVSAVVAAAKIAFNAAAGAYVKALVQPRDLLVANARFESTTWSSIAVGPPLGGAAIG
FT                   VFGPVVSVVADALSYLLSALGITAIRGREERPRRTESSRMRAGDLLDGWRYILAHPGLR
FT                   ALYANTVLVNGLIMATEPLLAVLLLGQLGFPPWQYGLAFAVPCVGGLVGSRLARRVVTR
FT                   YGQARVLRTAGMLRAVWLIGLAFIRPGMLGLVTVIAVEFAIIVNMSLFSPVLATYRLEH
FT                   TPKDRIARTLSAWSISSGLSIALFTALGGLLADATSPRTALTAAGVLILASPLLLRRPD
FT                   SFGRVSGPELPTEGRQPQVASVSGETG"
     MARRSLGRRF GWLWAAYAVS AYGSGLALGA FPLIAVLVLR AGPAKVSALS AVGPAMGALI        60
     ALPLGPWVEY RRRRPVMISM DLARFAALMT IPVAYAFGRL SFAQLLVVSA VVAAAKIAFN       120
     AAAGAYVKAL VQPRDLLVAN ARFESTTWSS IAVGPPLGGA AIGVFGPVVS VVADALSYLL       180
     SALGITAIRG REERPRRTES SRMRAGDLLD GWRYILAHPG LRALYANTVL VNGLIMATEP       240
     LLAVLLLGQL GFPPWQYGLA FAVPCVGGLV GSRLARRVVT RYGQARVLRT AGMLRAVWLI       300
     GLAFIRPGML GLVTVIAVEF AIIVNMSLFS PVLATYRLEH TPKDRIARTL SAWSISSGLS       360
     IALFTALGGL LADATSPRTA LTAAGVLILA SPLLLRRPDS FGRVSGPELP TEGRQPQVAS       420
     VSGETG                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page