(data stored in ACNUC7421 zone)

EMBL: CP002299.PE552

CP002299.PE552       Location/Qualifiers
FT   CDS             complement(702753..704408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0561"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: fal:FRAAL4374 putative
FT                   succinate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78640"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBB0"
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /protein_id="ADP78640.1"
FT                   /translation="MSAQVWDEVFDVVVVGSGAGALTSALLAADGGASVCVVEKSEYIG
FT                   GTTAASGGDMWIPCNRHIADQDTREEAIDYVTRLSDGRAYDPHLIEVYVDTAAEALDYL
FT                   ETHTGLVTRAHKGLPDYYAVVPGRIPGTKDVPRSVSCQPYPAVAELGAEWAARVNPSPW
FT                   VKPPEVAYAEAIEVVPREELLRRRAEGYRAKGGGLVAPLLKALLDRGVSVRWSTPGRDL
FT                   VTNEAGGVIGVVAGEDGALQRLGARKGVVLATGGFEWNEDMVKTFLGYDVKPCTPWTNT
FT                   GDGHRMAMRAGAKLGLMTSFFSYGVMHDPWEIGRDGNPLPQMEMGLGAGTIIVNQQGKR
FT                   FMHGGYTYNDFSHPFNFFDQRNPGFTNKAPGWCVFGAAKWEGKGVFGGHVVDGVIVGPN
FT                   GQPAPSWLLVANSIRELAEKMGVDPDTLEETVARYNEFAEKGEDPDWGDPQQVRSATGP
FT                   DTTSLKPVLGPIYGAILQWPGTLGTSGGPKIDADARVLGTETPIIDGLYAAGNTAASVL
FT                   GGTYPGGGSCVGPSMVMGYRAGRHAAAQPTRDIN"
     MSAQVWDEVF DVVVVGSGAG ALTSALLAAD GGASVCVVEK SEYIGGTTAA SGGDMWIPCN        60
     RHIADQDTRE EAIDYVTRLS DGRAYDPHLI EVYVDTAAEA LDYLETHTGL VTRAHKGLPD       120
     YYAVVPGRIP GTKDVPRSVS CQPYPAVAEL GAEWAARVNP SPWVKPPEVA YAEAIEVVPR       180
     EELLRRRAEG YRAKGGGLVA PLLKALLDRG VSVRWSTPGR DLVTNEAGGV IGVVAGEDGA       240
     LQRLGARKGV VLATGGFEWN EDMVKTFLGY DVKPCTPWTN TGDGHRMAMR AGAKLGLMTS       300
     FFSYGVMHDP WEIGRDGNPL PQMEMGLGAG TIIVNQQGKR FMHGGYTYND FSHPFNFFDQ       360
     RNPGFTNKAP GWCVFGAAKW EGKGVFGGHV VDGVIVGPNG QPAPSWLLVA NSIRELAEKM       420
     GVDPDTLEET VARYNEFAEK GEDPDWGDPQ QVRSATGPDT TSLKPVLGPI YGAILQWPGT       480
     LGTSGGPKID ADARVLGTET PIIDGLYAAG NTAASVLGGT YPGGGSCVGP SMVMGYRAGR       540
     HAAAQPTRDI N                                                            551
//

If you have problems or comments...

PBIL Back to PBIL home page